KEGG   Poecilia reticulata (guppy): 103460160
Entry
103460160         CDS       T05149                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103460160
   04068 FoxO signaling pathway
    103460160
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103460160
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103460160
   04920 Adipocytokine signaling pathway
    103460160
SSDB
Motif
Pfam: CBS SAPS Neur_chan_memb
Other DBs
NCBI-GeneID: 103460160
NCBI-ProteinID: XP_008400420
LinkDB
Position
Unknown
AA seq 474 aa
MMHNTRMLSMMLRTTTQVEVPGGMSEQPDQTDPGDAGSEESERDIYMRFMKCHKCYDIVP
TSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILTRYYKSPM
VQIYELEEHKIETWRELYLQETFKPLVHISPDASVFEAVHSLIKNKIHRLPVIDPISGNA
LYILTHKRILKFLQLFVCEMHMPAFMKQTLEELGVGTYSNIAYIHPDTPLIMALSVFTQR
RVSALPVVDHSGKVVDIYSKFDVINLAAEKTYNNLDVTVTQALRHRSQYFEGVMKCNKLE
TLETIVDRIVKAEVHRLVVVDDESHIIGIVSLSDILQALVLMPAGLGRKESITSQPEPLN
PAEPEPAAPNGSDQDPVLELEAESIPGPAGDPETETETDHNQDQNQDQDQDQNQNQDQDQ
DQDQNQNQDQDQNQDQDQNQNQDQVPETELDPDPQGATEEAPERSQQGEPEEGK
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgatgcacaacaccaggatgctgtctatgatgctgcgcactaccacacaggtggaggtc
cctggcggcatgtcggagcagccggatcagacggaccccggagatgccgggtccgaggag
tcggagagagacatctacatgcgcttcatgaagtgccacaagtgctacgacatcgtcccc
accagctccaaactggtggtgtttgacacaacgctgcaggtgaagaaggccttcttcgcg
ctggtggctaacggggtgagagctgctcctctgtgggagagcaagaagcaaagctttgtg
ggaatgttgaccatcacagacttcatcaacatcctgaccagatactataaatcccccatg
gtgcagatctatgagctggaggagcataagatcgagacgtggagagagctgtacctgcag
gagaccttcaaacctctggtgcacatctcacctgacgccagtgtgttcgaagcggttcac
tccctgataaagaacaagatccaccggcttcctgtcatcgatccgatcagcggcaacgct
ctctacatcctgactcacaagcggatcctgaagttcctgcagctctttgtgtgtgagatg
cacatgccagccttcatgaagcagacactggaggaacttggagtgggaacgtactccaac
attgcctacatccaccccgacacgccgctcatcatggccctgtctgtgttcacacagcgc
cgggtctctgcgctgcccgttgtggatcacagcgggaaggtggtggacatctactccaag
tttgacgtgattaacctggcagctgagaagacttacaacaatctggatgtgacggtcacc
caggctctaagacacagatcgcagtactttgaaggcgtcatgaagtgcaacaagctggaa
acactggagaccatcgtggaccggatcgtgaaggctgaggtccacaggctggtcgtggtt
gacgatgagtctcacatcattggcatcgtgtcgttgtcggacatcttgcaggcgctggtc
ctgatgcctgctggactggggaggaaggagtccatcacctcccaaccagaacccctgaac
ccagcggaaccagaaccagcagctccaaatgggtcagaccaggacccggttctggagctg
gaggcagaaagcatcccgggaccagcaggcgacccagagacagaaaccgaaacagatcac
aatcaggaccagaaccaggaccaggaccaagatcagaaccagaaccaggaccaggaccag
gaccaagaccagaaccagaaccaggaccaagaccagaaccaggaccaagaccagaaccag
aaccaagaccaggtaccagaaactgaactggacccggatccccaaggagccacagaggaa
gctcctgagaggagccagcagggggagccagaggaggggaagtaa

KEGG   Poecilia reticulata (guppy): 103463785
Entry
103463785         CDS       T05149                                 

Gene name
prkaa2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103463785 (prkaa2)
   04068 FoxO signaling pathway
    103463785 (prkaa2)
   04150 mTOR signaling pathway
    103463785 (prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103463785 (prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103463785 (prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103463785 (prkaa2)
   04920 Adipocytokine signaling pathway
    103463785 (prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103463785 (prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103463785 (prkaa2)
   03029 Mitochondrial biogenesis [BR:pret03029]
    103463785 (prkaa2)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103463785 (prkaa2)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   103463785 (prkaa2)
Membrane trafficking [BR:pret04131]
 Autophagy
  Other autophagy associated proteins
   Others
    103463785 (prkaa2)
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103463785 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    103463785 (prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH YukC
Other DBs
NCBI-GeneID: 103463785
NCBI-ProteinID: XP_008405603
UniProt: A0A3P9QAU1
LinkDB
Position
LG4
AA seq 557 aa
MAERQQQKHEGRVKIGHYILGDTLGVGTFGKVKIGQHQLTGHKVAVKILNRQKIRSLDVV
GKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKNGRVEDSEARR
LFQQIISAVDYCHRHMVVHRDLKPENVLLDANKNAKIADFGLSNMMSDGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEHLN
RSVASLLMLMLQVDPLKRATIKDIREHEWFKKDLPGYLFPEDPSYDATVLDEEAVREVCE
KFECTESEVVSSLYSGDPQDQLAVAYHLIIDNRRIMTQASEFYLASSPPQGSFIEEGMPL
PPGVKPHPERMPPLLADSPKSRCPLDALNTTRPKPLAVKKAKWHLGIRSQSRPYDIMAEV
YRAMKQLNFDWKVVNPYHLRVRRKNPVTGNLVKMSLQLYQVDNRSYLLDFKSIDDDIMEA
VGFKSGSSTPQRSGSTAGLHRPRLSIDSASPAIDLPQLSSSLPGSLSGSYPLLAARQGSH
TMDFFEMCASLITTLAR
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggcagagcggcaacaacagaaacacgaaggcagggtaaagatcggccattacatcctc
ggcgacacgctcggagtggggacgttcgggaaagtgaagatcggacaacatcaattaacg
ggccacaaagtcgccgtgaagatcctcaacagacagaagatccgcagtctcgatgttgtg
gggaaaatcaagcgggagatccagaacctcaaactgttcagacacccccacatcatcaag
ctctaccaggtaataagtacaccaacagatttcttcatggtcatggagtatgtgtctgga
ggggagctgtttgactacatctgcaaaaacggaagggtggaggactcggaagctcgccgt
cttttccagcagatcatctcggctgtggattactgtcacaggcacatggtggtccacaga
gacctcaaacccgagaacgtcctgcttgacgccaacaagaacgccaagattgccgacttc
ggactttcaaacatgatgtcagacggagagttcttacgaacgagctgtgggtcgcccaac
tacgcggctccggaggtcatctcaggaaggctgtacgcaggcccagaggtggacatctgg
agctgcggcgtgatcctgtacgcgctgctgtgtggcactctgcccttcgacgacgagcac
gtccccacgctgttcaagaagatcagaggaggcgtcttctacatccccgagcacctgaac
cgctctgtggcgtcgctgctcatgctcatgctgcaggtggacccacttaagagagccacc
atcaaagacatcagggaacacgagtggtttaagaaggacctgccgggctacttgttccca
gaggacccgtcatacgatgccaccgtgctggacgaagaggcggtcagggaagtgtgcgag
aagtttgaatgcaccgagtctgaagtggtgtccagcctctacagcggagatccacaggat
cagttagcagtagcttatcacctcatcatagataaccgacgcatcatgacccaggccagc
gagttctacctggcctccagtcctccgcagggctccttcatcgaagaaggcatgccgctg
ccccccggcgtcaaaccccacccagagaggatgcccccgcttctggccgacagccccaaa
tcccgttgtcctctggatgccctgaacacaacccggcccaaaccgctcgctgtgaagaag
gccaaatggcacctggggatcaggagtcagagcagaccgtacgacatcatggctgaggtg
tacagagccatgaaacaactcaactttgactggaaggtggtgaacccgtaccatctgcgg
gttcgccggaagaatccagtaacgggaaatctggtgaaaatgagcctgcagctctaccaa
gttgacaacagatcctacctcctcgatttcaagagcatcgatgacgacatcatggaggcg
gttggctttaaatctgggtcgtccacccctcagcggtcgggctccaccgccggcctccac
agaccccgactgagtatcgactcggccagccccgccattgacctgccccagctcagctcc
tccctgccaggctcgctgtccggcagctaccccctgctcgccgcgcgtcaaggctctcac
accatggacttcttcgaaatgtgcgccagtctcatcaccacgctggctcgctga

KEGG   Poecilia reticulata (guppy): 103465268
Entry
103465268         CDS       T05149                                 

Gene name
prkag1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103465268 (prkag1)
   04068 FoxO signaling pathway
    103465268 (prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103465268 (prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103465268 (prkag1)
   04920 Adipocytokine signaling pathway
    103465268 (prkag1)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 103465268
NCBI-ProteinID: XP_008408140
UniProt: A0A3P9PAW6
LinkDB
Position
LG5
AA seq 334 aa
MECIPVSIDDLEGKKDPIIEEREQNVYTRFMKSHRCYDLVPTSSKLVVFDTSLQVKKAFF
ALVSNGVRAAPLWDSKKQCFVGMLTITDFINILHRYYKSPLVQIYELEEHKIETWREVYL
QDSFKPLVCISPNASLYDAVSSLLRHKIHRLPVIDPLTGNTLYILTHKRILKFLKLFISE
MPRASFLNQTLEELNIGTFKNIAVVRADTPLYTALGIFVEQRVSALPVVDDKGRVVDIYS
KFDVINLAAEKTYNNLDVTVTKALKHRSQYFEGVLTCNRHETLEAIITRLVEAEVHRLVV
VDENEVVKGIVSLSDILQALVLTDGEDGTTLGSN
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggagtgtatcccagtaagcattgatgatcttgaaggcaaaaaggatccaatcattgaa
gaacgagagcaaaatgtttacaccaggtttatgaagtcgcaccgctgctacgaccttgtg
cccactagttccaagttagtggtgtttgatacgtcgcttcaggtgaagaaggcgttcttt
gcgcttgtttcaaatggggtgagagcagctcctctgtgggacagcaagaagcagtgcttt
gtgggtatgctaactatcacagacttcattaacattcttcatcgctactacaagtctccc
ttggttcagatatacgagttggaagagcacaaaattgaaacgtggagagaggtgtacctt
caagactccttcaagcctttggtttgcatatctcccaatgccagtttgtatgacgcggtg
tcgtctctgctgaggcacaagatccacaggttgcctgtaatcgacccgctgacagggaac
acgctgtacatcctcacacacaagaggattcttaagttcctgaagctttttatatcagag
atgccaagagcctcgttcttgaatcagactttagaggaactgaacattgggacgttcaag
aacatagcagtggtccgagcagacacccctctgtacacggcgctgggtatttttgtggag
cagcgagtgtccgcgctccctgttgtggatgacaaaggtcgagtggtggacatatactca
aaatttgatgtcataaatctggctgcagagaagacgtacaacaacctggacgtgactgtg
accaaggcgttgaagcatcgctcgcagtactttgagggagtcctgacctgcaacagacat
gagaccctggaagccatcatcaccagactggtggaggccgaggttcacagactcgtggtc
gtcgatgagaacgaagtggtgaagggaatcgtctccctttccgacatcctccaggcgctg
gtgttgaccgacggagaagacggcacaactttagggagtaattag

KEGG   Poecilia reticulata (guppy): 103469702
Entry
103469702         CDS       T05149                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103469702
   04068 FoxO signaling pathway
    103469702
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103469702
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103469702
   04920 Adipocytokine signaling pathway
    103469702
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 CBM53
Other DBs
NCBI-GeneID: 103469702
NCBI-ProteinID: XP_008415783
UniProt: A0A3P9Q713
LinkDB
Position
LG9
AA seq 265 aa
MGNSSSDRSSNERSFRDGPSGGKEARPNIMMDSNDDAELFHREDPKATPDIQEFLAWQQD
LDCDSKEPAQARPTVFRWAGSAKEVFVSGSFNNWATKIPLNKSQNNFVAIVDLPEGEHQY
KFCVDGQWTLDPTGPVTTTKTGTVNNVIQVNQTDFEVFDALKIDSQDSTDLSDLSSSPPG
PYQQNGYLIKPDDKIKQPPILPPHLLQVLLNKDTGVSCDPTLLPEPNHVMLNHLYALSIK
DGVMVLSATHRYKKKYVTTLLYKPI
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggcaacagcagcagcgatcgctccagcaacgagaggtcattcagagatggaccgtct
ggagggaaggaggctcgacccaacatcatgatggacagcaacgacgacgcagagctgttc
cacagggaagatccgaaggctaccccagacatacaggagtttctggcctggcagcaggac
ctcgactgcgacagtaaggagccggcgcaggccagaccgaccgttttcagatgggccggg
tcggccaaagaagtctttgtgtctggttcttttaacaactgggccaccaaaatccctctt
aacaagagtcagaataacttcgtggccattgtggacctgccagagggggagcaccagtac
aagttttgcgttgacggacagtggactttagatcccactgggcccgtgacaacaaccaag
actggcacagtcaacaatgtcattcaggtgaatcaaactgacttcgaagtcttcgatgcc
ctcaagatcgattcgcaggattcaacggacttgtctgacctgtccagttccccacccggg
ccctaccaacagaacggatacctcatcaagccagacgacaagatcaagcagcctcctatc
ttgccgccccacctgctccaagtgctgctcaacaaggacacaggtgtctcttgtgacccg
acactacttccagagcctaaccacgtcatgctgaatcacctgtacgccctctccatcaag
gacggggtgatggttctcagcgctactcaccgatacaaaaagaaatacgtgaccactctc
ctctacaaacccatataa

KEGG   Poecilia reticulata (guppy): 103473399
Entry
103473399         CDS       T05149                                 

Gene name
prkaa1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103473399 (prkaa1)
   04068 FoxO signaling pathway
    103473399 (prkaa1)
   04150 mTOR signaling pathway
    103473399 (prkaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103473399 (prkaa1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103473399 (prkaa1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103473399 (prkaa1)
   04920 Adipocytokine signaling pathway
    103473399 (prkaa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103473399 (prkaa1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103473399 (prkaa1)
   03029 Mitochondrial biogenesis [BR:pret03029]
    103473399 (prkaa1)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103473399 (prkaa1)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   103473399 (prkaa1)
Membrane trafficking [BR:pret04131]
 Autophagy
  Other autophagy associated proteins
   Others
    103473399 (prkaa1)
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103473399 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    103473399 (prkaa1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH YukC
Other DBs
NCBI-GeneID: 103473399
NCBI-ProteinID: XP_008421846
LinkDB
Position
LG12
AA seq 564 aa
MATEKQKHEGRVKIGHYILGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQKIRSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLEEKESRRL
FQQIISAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFFTPQYLNP
SVVSLLKHMLQVDPMKRATIKEIREDDWFKQDLPKYLFPEDPSYSNNMIDDEALKEVCEK
FECTEEEVLSCIYSRNHQDPLAVAYHLIIDNRRIMSEAKDFYLASSPPDNFLDDVAGIIK
PHPERLPIFVAEPPPRSRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDIMTEVCRAM
KQLDYEWKVVNPYYLRVRRKNPITGMQTKMSLQLYQVDSRTYLLDFRSIDDDMLETKSGT
ATPLRSGSVGNHRATVKSDAEGADVSATSSTVQPTKTAEGSLGSSLTSSVDSSGGADSTP
APRPGSHTIEFFEMCANLIKLLAR
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggcgacggagaaacagaaacacgagggaagagttaaaattggacattacattctcggt
gatacgcttggagtcgggactttcgggaaggttaaagtgggccaacatgagctgaccaag
caccaagtggctgtgaaaatcttgaacaggcagaagatccgcagtttggacgtggtggga
aaaatccgccgggagatccagaacctcaagcttttcaggcaccctcacataattaaactg
tatcaagttattagcacccctacagatatcttcatggtcatggagtatgtctcaggtgga
gagctcttcgattacatctgcaaaaatggaaagttggaagagaaggagagtcggcgactg
ttccagcagatcatatcagcggtagattactgccaccggcacatggtggtgcacagagac
ctcaaacctgagaacgtgctgctcgatgcgcacatgaatgcaaagatcgcagatttcggt
ctgtcaaacatgatgtcagatggagagttcctgagaacaagttgcggttctccaaactat
gctgctccagaggtcatctcaggaaggttatacgccggtccagaggtggatatatggagt
agtggtgtcattctgtatgcattattgtgtgggacgctccccttcgatgacgaccatgtg
ccaacgctctttaaaaagatctgcgatgggatctttttcacgccgcagtatctgaacccc
tcagtagtaagccttcttaaacacatgctgcaagtggacccaatgaaaagggcaactatt
aaagagatccgtgaggacgattggttcaaacaagatctgccaaagtacttgtttcctgag
gacccctcctacagcaacaacatgattgatgatgaggccttgaaagaagtttgtgagaag
ttcgagtgcaccgaggaggaggttctctcctgcatttacagccgcaaccaccaggacccg
ttagcggtggcctaccacctaatcatcgacaatcggcgcatcatgagcgaggccaaggat
ttctacctggcctcgagcccgcccgacaattttctggacgacgtggctggaatcatcaag
ccccaccccgagcgtttacccatctttgtggcggagcctcctccgaggtctcgccacaca
ctggacgaactgaacccccagaagtccaagcaccaaggcgtacggagagccaagtggcac
ctggggattcgcagtcagagcagacccaacgacattatgaccgaagtgtgccgtgcaatg
aaacagctggattacgagtggaaggttgttaatccatattatctgcgtgtgaggaggaag
aatcctatcacaggaatgcaaaccaagatgagccttcaactctaccaggtggacagcaga
acctacctccttgactttcgtagcatagatgatgatatgctggagactaaatctggaact
gctacccctctccgctctgggtccgtgggcaaccaccgcgccacagtaaagagcgacgca
gagggagcagacgtttcggccacctccagcactgtgcagcccaccaagaccgccgaaggc
tccctaggttcctctctgacctcgtccgtcgactcgtcgggtggtgcggacagcacgccc
gccccccgaccggggagccacaccatcgagttctttgagatgtgtgcaaatcttattaaa
ctacttgcacgatag

KEGG   Poecilia reticulata (guppy): 103475605
Entry
103475605         CDS       T05149                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103475605
   04068 FoxO signaling pathway
    103475605
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103475605
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103475605
   04920 Adipocytokine signaling pathway
    103475605
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 103475605
NCBI-ProteinID: XP_008425612
LinkDB
Position
LG2
AA seq 411 aa
MEPLSQVSCSPEEPKVKKQGLFTRATLLQLCTCRHLYISWYVLVHHILYACVCLHADEPL
WVLPEADTTVYLNFMKSHTCYDAIPISCKLVIFDTTLQVFQPREVGPHSSFLFLQPKQHI
KIKIRGIKVKKAFFALVANGLRAAPLWDSKLQRFVGMLTITDFINILHCYYKSPMVQMYG
LESHKIETWRGDSLQNVYLKSPTQFLISISPQASLFDAIYSLLRYKIHRLPVIDPESGNV
LHILTHKRILKFLHIFGKNLPKPAFLKRPVQELGIGTFRNIATVHQTSSLYEALSIFVER
RVSALPVVDGQSKVVALYSRFDVINLAAQKTYNNLDMTMEEAIRRRTCCVEGVMKCYPDE
SLETVIDRIVKAEVHRLVLVDRLDVVKGIISLSDLLQALVLTPAGIDALLS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggagcctctttcacaggtgtcgtgttcaccagaggagccgaaggtgaagaaacaaggt
ttgtttacaagggccactctgttgcagttgtgcacatgcaggcatttgtacatttcttgg
tatgtgttagtgcatcacatattgtatgcatgcgtctgtctccacgctgatgaaccgctg
tgggttctcccagaggctgataccacggtctacctcaacttcatgaaaagtcacacttgc
tacgacgccattccaatcagctgcaaactggttatatttgatacaacattacaggtattc
cagcccagggaggtcggaccacattcctctttcctgttcttgcagccgaagcagcacatt
aagatcaagatcagaggaataaaagtgaaaaaggccttttttgccctggtggcaaatggc
ttgagggctgcccctctctgggacagcaagctgcagaggtttgtgggtatgctgactatt
actgatttcatcaacatactccattgttattacaagtcaccaatggtccaaatgtatgga
ctggagagccataagattgaaacatggagaggtgattcccttcaaaatgtgtacttaaag
tctccaactcagttccttatcagtatttctccgcaggccagcctcttcgatgccatctat
tccttactcagatacaagatccacaggctgcctgtcatcgacccggagtcgggaaacgtt
ctgcacatcctgacccacaagcgaatcctcaagttcctgcacatatttggaaaaaatttg
cccaagcctgcatttctaaagaggcctgtccaggagctgggcatagggacgttcaggaac
attgctacagtccaccaaacatcatcgctttatgaagccctgtccatatttgtggagcgg
cgagtgtcggcactccctgtggtggatgggcaaagcaaagtggtggcgctctactcaaga
tttgatgtcatcaatctggcagcccagaagacctataacaacctggacatgacgatggag
gaagccattcgaagacgcacgtgttgcgttgagggtgtgatgaagtgctatccagatgaa
tctttagaaacggtcatagatcggatagttaaagcagaggtccaccggctggttctggtg
gacaggttggacgtcgtgaagggcattatctctctgtctgacctcctgcaggctttggtc
cttacacctgcagggatcgatgctcttctatcctag

KEGG   Poecilia reticulata (guppy): 103479357
Entry
103479357         CDS       T05149                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103479357
   04068 FoxO signaling pathway
    103479357
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103479357
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103479357
   04920 Adipocytokine signaling pathway
    103479357
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 103479357
NCBI-ProteinID: XP_008431951
UniProt: A0A3P9PME4
LinkDB
Position
LG17
AA seq 267 aa
MGNTSDRVSGDRHGKAHRTDSGGSHKDQESGSKMVDSTDDPNVFNTHGPESKSSGDKEFT
PDLDDLVKTGPQARPTVIRWAGGGKEVYIAGSFNNWSNKIPLNKSHNDFVAILDLPEGEH
QYKFFVDGQWLHDPSEPVVTSQLGTINNLITVKKSDFEVFDALQVDSLECSDTSDLSSSP
PGPYGQEQYIFRPEEHFKAPPILPPHLLQVILNKDTNVSCDPALLPEPNHVMLNHLYALS
IKDGVMVLSATHRYKKKYVTSLLYKPI
NT seq 804 nt   +upstreamnt  +downstreamnt
atgggtaacacaagtgaccgagtgtctggagatcgccacgggaaagcccatcgcaccgac
agcggcggcagccacaaggaccaggagtctggcagcaagatggtggacagcacagacgac
cccaacgtcttcaacacacatggacctgagtcaaagtcttcaggagacaaagaattcact
cccgatctggacgacctggttaaaaccggtcctcaggctcgacccactgttattcgctgg
gctggcgggggtaaagaagtctatatagctggttccttcaataactggagcaacaagata
cccctaaataagagccacaatgactttgtagccattctggacctgcctgaaggagagcac
cagtacaagttttttgtagatggacagtggctccatgatccctctgagccggtggtaaca
agccagctgggcaccatcaacaacctgatcactgtgaagaagtcggactttgaggtgttt
gaygccctgcaggtcgactctctggagtgctccgacacttcagacttgtccagctcccct
ccaggaccttacggccaggaacagtacatctttagaccagaagagcacttcaaagcgccg
cccatcctccctcctcacctgcttcaagttattctcaacaaagacaccaatgtatcgtgt
gatcctgccctgctgcctgaacccaaccatgtcatgcttaatcacctttatgctctctca
ataaaggacggagtaatggtcctcagcgctactcacagatacaagaagaaatacgtcacc
tctttgctttacaagccsatctaa

KEGG   Poecilia reticulata (guppy): 103479581
Entry
103479581         CDS       T05149                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103479581
   04068 FoxO signaling pathway
    103479581
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103479581
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103479581
   04920 Adipocytokine signaling pathway
    103479581
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 103479581
NCBI-ProteinID: XP_008432312
UniProt: A0A3P9N923
LinkDB
Position
LG17
AA seq 442 aa
MKRFGSLRRSKKRKEQDGLEGRHPSEASCLAASGFSTPPTTPTQALNQPVFSQEAQQQSG
PSPERLEPGTLARSLSTPPDTGQRFSLPHTKPPIPSTSPVPPISTSQHVYGLFEGMLEKL
ELDDDAAEPESDIYMRFMKSHKCYDIVPTSSKLVVFDTALQVKKAFFALVANGVRAAPLW
DTEKQSFVGMLTITDFIIILHRYYKSPMVQIYELEEHKLETWREVYLQATFKPLVNISPD
ASLFDAVYTLIKNKIHRLPVIDPVTGNALYILTHKRILKFLQLFVCEMPKPAFMKQTLGE
LGIGTYHEIAFIHPDTPIIKALNIFVERRVSALPVVDDSGKVVDIYSKFDVINLAAEKTY
NNLDITVTQALKHRSQYFEGVVKCHKMETMETIVDRIVKAEVHRLVVVDERSSIEGIVSL
SDILQALVLSPADACKEENLTE
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaagcggtttggcagcctaaggaggagcaagaaacgaaaagagcaggatgggctagaa
gggaggcatccgtccgaggcttcgtgtctggccgcttctgggttctccacacctcccacc
actccgacccaggcattgaaccagcctgtgttcagccaggaggcccagcagcaaagcggc
cccagcccagaacgcctggagcccggtaccctagcccgctccctgtccacgcctccggac
acaggacagcgcttcagccttccccacaccaaacccccgatcccatcaaccagccctgtg
ccacccatctctacctcacaacatgtctacggcttattcgaaggtatgctggagaaactt
gaactagacgatgatgctgctgaacccgagagtgatatttacatgcgctttatgaaatcc
cacaagtgctacgacatcgtccccacaagctccaagctggtcgtgtttgacacagcgctt
caagttaagaaggcattctttgccttggtggctaacggtgtccgagctgctcctctatgg
gacacagagaagcaaagctttgtgggaatgctgacaatcacagatttcatcatcatactg
cacagatactataagtcaccgatggtgcaaatttatgagttggaggaacacaagcttgaa
acttggagagaggtttatcttcaagcaacgtttaaacctcttgtgaacatatcaccggat
gcaagtctgtttgatgcagtgtacaccctcatcaaaaataaaattcaccgcctgcctgtc
atcgaccctgttacagggaatgcactttatattctgacgcacaagcggatcctaaagttc
ctccagctgtttgtgtgtgaaatgccaaagccagcgttcatgaagcagaccctaggtgag
ctcggcatcgggacgtaccatgaaatcgctttcatccacccagacacgcctatcattaaa
gccctcaacatcttcgtggagagacgggtgtctgctctccctgtggtggatgactcgggc
aaagttgtggatatttattccaaattcgatgtgattaacttggccgcagagaagacgtac
aataacttggacatcacggtgacgcaggctctgaaacatcgctcgcagtacttcgaagga
gttgttaagtgccacaaaatggaaacaatggagaccattgtggacagaatagtcaaagca
gaagttcatcggctggtggtggttgatgagcgctccagcatcgagggcatcgtttccctt
tcagacatcctccaggcactggtgctcagcccagcagatgcctgtaaggaggagaatctt
actgaatga

KEGG   Poecilia reticulata (guppy): 103482256
Entry
103482256         CDS       T05149                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04371  Apelin signaling pathway
pret04530  Tight junction
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103482256
   04068 FoxO signaling pathway
    103482256
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103482256
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103482256
   04920 Adipocytokine signaling pathway
    103482256
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 103482256
NCBI-ProteinID: XP_008436510
LinkDB
Position
LG2
AA seq 392 aa
MDSFAEVPLFEMDEYEEEEVLSVRSRGVCTYATYPMAPPAGADPDTYIYMNFMKSHSCYD
AMPRSSKLVIFDTTLQVKKAFFALVANGVRAAPLWDSKLQCFVGMLTITDFINILHRYYK
SPLVQIYELEEHKIETWREIYLEYSVNRLISIKPASSLFDAIYSLLKNKIHRLPVIDPAS
GNVLHILTHKRILKFLHIFGSMIPKPRFLQKQINEVPIGTFREIATIQESASVYEALAIF
VERRVSALPVVNEQGKVVALYSRFDVINLAAQKNYNNLNMTMKEALTSRSCWVEGVLKCY
PHETLETIIDRIAKAEVHRLVLVDREDVVRGIVSLSDILQALILTPAVSSLPSPKVPASI
SQIFTSGQPFKSEENKMAADDVKRDDKVKNRA
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggattcctttgcagaggtccccttgtttgagatggatgagtatgaggaagaagaagtt
ctctcggtgaggagcagaggtgtctgtacatatgccacataccccatggcgccccctgca
ggagcagatcctgacacctacatttacatgaatttcatgaagagtcacagttgctatgat
gccatgcccaggagctccaaactggtcatctttgatacaacgctgcaggtgaagaaggct
ttctttgctctggtggcgaacggagtgcgggcggcgccgctgtgggacagcaagctgcag
tgttttgtaggtatgctaaccattacggactttattaacatccttcatcgctactacaag
tctcccttggttcagatctacgaactggaagaacacaaaatagagacatggagagaaata
tatctggagtattcagtcaacagactcatcagcatcaaacctgcatccagtttgtttgat
gccatctactccctgctaaagaataagatccaccggctcccagttattgacccagcttct
ggaaatgtcctccacatcctgacacacaagcggatcctcaaattccttcacatctttggc
tccatgattcctaaacccaggtttcttcaaaagcagatcaacgaggtgccgattggcacc
tttagggagattgcaacaatccaggaatctgcctctgtctatgaagctctggctattttt
gtggaaagaagagtgtcagccctgcctgtggttaatgaacaaggtaaagttgtggcactg
tactccagattcgatgtcattaaccttgctgcccaaaaaaattacaacaatttaaacatg
acaatgaaagaggccctcacgtcacgatcctgctgggttgaaggagtccttaaatgttat
ccacacgaaacactggagaccatcatcgaccgcatagctaaagctgaggttcatcgacta
gttttggttgacagagaagatgtggtgagagggattgtctctctgtctgatattctgcaa
gccctgattctcactcctgcagtgtcatcacttccttctcctaaagttccagccagcatt
tcccagatatttacaagtggccaacctttcaagtctgaagaaaacaagatggcagctgac
gatgtaaaacgggacgataaagtgaagaaccgagcttaa

DBGET integrated database retrieval system