KEGG   Poecilia reticulata (guppy): 103460510
Entry
103460510         CDS       T05149                                 

Definition
(RefSeq) agouti-related protein
  KO
K05231  agouti related protein
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103460510
SSDB
Motif
Pfam: Agouti SEP
Other DBs
NCBI-GeneID: 103460510
NCBI-ProteinID: XP_008400943
LinkDB
Position
Unknown
AA seq 132 aa
MLGMLLLCCASSSLLQPAASLVHGGIRLDDGPAAAVRPDAAYLADIDRGHAPSPLQDGGL
LPVDSEEDRLLMEVGSNNEDSSALQQQGRAVRSPRRCIPHQQFCLGYSLPCCDPCDTCYC
RFYNAICYCRGK
NT seq 399 nt   +upstreamnt  +downstreamnt
atgttgggcatgctgctgctctgctgcgcctcctccagtctgctgcagccggccgcctcc
ctggtccacggaggaatccggctggacgacggcccagcggccgccgtccgccccgacgcc
gcctacctggctgacatcgatagaggccacgcccccagccctcttcaagatggcggtctc
cttcctgtggactcagaggaagaccgcttgctgatggaagtgggctccaacaatgaggac
tcgtctgcgctgcagcagcaaggcagagccgtgcgttcgcctcgccgctgcatccctcac
cagcagttctgtctgggttactcactgccctgctgcgacccctgtgacacctgctactgc
cgcttctacaacgccatctgctactgccgagggaaatag

KEGG   Poecilia reticulata (guppy): 103479079
Entry
103479079         CDS       T05149                                 

Definition
(RefSeq) agouti-signaling protein-like
  KO
K05231  agouti related protein
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103479079
SSDB
Motif
Pfam: Agouti
Other DBs
NCBI-GeneID: 103479079
NCBI-ProteinID: XP_008431527
UniProt: A0A3P9NK74
LinkDB
Position
LG17
AA seq 115 aa
MRRTTGRHLLCLLLLFFPLSWAEDTKKDARKTENVTVWGQTKTRRIFARHKISPADQTHI
RHKSHILTPARRCGRLMENCSSHLPCCDPCASCRCRLFNTICHCWRMNPLCLKRT
NT seq 348 nt   +upstreamnt  +downstreamnt
atgagaaggaccactggcagacacttgttgtgcttgctgctgcttttctttccgctctcg
tgggcagaggacacgaaaaaagacgcgaggaagaccgagaatgttacagtttggggacaa
actaaaacaagacgaatatttgcgaggcataagatttctccagcagatcagactcacatt
agacacaagtcccacatcttgaccccagcgcggcgctgcggccgcctgatggagaactgc
tcctcacacttgccttgctgcgacccgtgcgcctcctgccgctgccggctcttcaacacc
atctgtcactgctggaggatgaatccgctctgcctgaagaggacctag

KEGG   Poecilia reticulata (guppy): 108165703
Entry
108165703         CDS       T05149                                 

Definition
(RefSeq) U13-lycotoxin-Ls1d-like
  KO
K05231  agouti related protein
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108165703
SSDB
Motif
Pfam: Agouti
Other DBs
NCBI-GeneID: 108165703
NCBI-ProteinID: XP_017157331
LinkDB
Position
LG20
AA seq 148 aa
MKLAVHCLCFLHFVLLSFGLDTYISLSRSKAFHSDATYVNQDRVRTLFARRALYEQQKIH
ETKKSSIVPPPQPQNDVSRPKAVPKPQVTARCSLLGQSCVPLCGCCDPCTTCHCRFFNAI
CYCRRAEQARPRCGSKKTAKRRKSKTQL
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaagttggcagttcactgtttgtgctttctgcatttcgtccttctgagttttggactg
gacacttacatttcactcagcagaagcaaagcctttcacagtgatgcaacttatgtaaac
caagacagagtgagaactctgtttgccaggagggcactgtatgaacagcagaagatccac
gagacaaaaaagtccagcattgttcctcctcctcagcctcaaaacgacgtttctcgtccc
aaagcggtgccgaagccccaggtgacggccaggtgctccctgctgggacagagctgcgtg
ccgctgtgcggctgctgcgatccgtgcacaacgtgccactgccgcttcttcaacgcaatc
tgctactgccggcgagcggagcaagcgaggccacgatgtgggagtaaaaagacagcgaag
agaagaaagtcaaagacgcaactctaa

DBGET integrated database retrieval system