KEGG   Poecilia reticulata (guppy): 103460709
Entry
103460709         CDS       T05149                                 

Definition
(RefSeq) signal transducer and activator of transcription 1-like
  KO
K11220  signal transducer and activator of transcription 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04217  Necroptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103460709
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103460709
   04621 NOD-like receptor signaling pathway
    103460709
   04625 C-type lectin receptor signaling pathway
    103460709
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103460709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103460709
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103460709
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Fib_alpha bZIP_1
Other DBs
NCBI-GeneID: 103460709
NCBI-ProteinID: XP_008401214
LinkDB
Position
Unknown
AA seq 708 aa
MAQWQELLKLDSALQNRVRQLYEGRFPTEIRNQLSHWIESQDWSSAAVNENAAAACFCAL
LQHLEEQWRRSVQENAILQGPDFPRMRAYIVENFQAQPLNLAAILSECLKEEKQILESVT
MTMGGSAVVMAPQWTELDNRVKQLKLQLLELKKEVKVLEDLSEKLDFIRNSWQNKVEQNV
ELVQSKALVEQECLKLARSISQTKQVVLQRLVSVLNEAAGSVQTLTGVELPQWRRRQQRS
CIGSPEDAGLDLLEKWFTAVAEVLLGVGEQLQRLQVQNQRFPAPDFPGLTDSVAEMEKFC
RGLIRSLLTSALVVEKQPVMQNLPQRPLILKTGVRFKVTVRFLVNLPAFKTLIKVKPVFD
KDVEEVKTISGFRQFDFPRDDSKVLDVDLSSGALTAAFEHMSLKEKKSRVKGSCESQLTV
TEELHVIRFVTQLQHNGETVHIQVTSKTSELVLDRLTARSGSGPALGPFRFWTDGPDGPD
GPIHWNKFSKDESVWIWIDGILDLIKKFVWELWRDGCIMGFVSKERTRSLLREKPVGTFL
IRFSESIRDGAITFSWVEQSAGEKHVHAVEPYTKKELSVLSLPNAIYNYTLTTAGRSHNP
LVYLYPDTPKDAAFARYRAAEPSPPSRNIKDYLSRKITLVSIDPTPPPSPPRDMPMTDMD
LEYPEVDLNDILKDLEDLLDLPDLLHVHQSSPLESFSDPGFXNQFISQ
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggcccagtggcaggagctgctgaagctggactcggcgctgcagaaccgggtcaggcag
ctrtacgagggccggttccccacagagatccggaaccagctgagccactggatcgagagc
caggactggagttctgcggctgtgaacgagaatgcagcggctgcgtgtttctgcgctctg
ctgcagcatctggaggagcagtggcgccgctcggtccaggagaacgccatcctgcagggg
cccgacttccccaggatgagggcctacatagtggagaacttccaggctcagccgctgaac
ctggccgccattttgtctgagtgtctgaaggaggagaagcagatcctggagtcggttacc
atgacgatgggcggcagcgctgtcgtcatggcgccgcagtggacggagctggacaaccga
gtgaagcagctgaagctgcagcttctggaactgaagaaggaggtgaaagttctggaggac
ctgagcgaaaaactcgacttcatccggaactcgtggcaaaacaaagtggagcagaacgtg
gaactggtccagtccaaggccctggtggagcaggagtgtctgaagttggcccggtccatc
tcccagaccaaacaggttgtgctgcagcggctggtcagcgttctgaacgaggcggccggt
tccgtccagactctgaccggagtggagcttcctcagtggcggcggcggcagcagcgatcc
tgcatcggcagccctgaggacgccggcctggacctgctggagaaatggttcacggcagtg
gctgaggttctgctcggtgtcggtgaacagctgcagcggctgcaggtccagaaccagagg
ttccccgccccggacttcccgggcctcaccgactccgtggcagaaatggagaagttctgc
cgcggtctgatccggagcctgctgaccagcgccctggtggtggagaagcagcccgtcatg
cagaaccttcctcaacggccgctgatcctgaagaccggcgttcgcttcaaggtcactgtg
aggtttttggtgaaccttccagctttcaagactctgatcaaagtcaaacctgtttttgac
aaggacgtggaggaagtgaagacgatcagcggttttcggcagttcgatttcccgcgtgat
gactccaaggttctggacgtggatctgtccagcggcgcgctgacggcggcgttcgagcac
atgtcactcaaagaaaagaagtccagagttaaaggttcctgtgagagccagctgacggtc
acagaggagctgcacgtcatccgcttcgtcacgcagctgcagcacaacggggagaccgtc
cacatccaggtgaccagtaaaaccagtgaactggttctggaccggctgacggcccgctcc
ggttctggaccggctctcggcccgttccggttctggaccgatggtcctgatggtcctgat
ggtccgattcactggaacaagttttccaaggatgagagcgtgtggatctggatcgatggg
attctggatctgatcaagaagtttgtgtgggagctgtggcgggacgggtgcatcatggga
tttgttagcaaggagagaacgcgctccctgctgcgggagaaaccggtcgggacgtttctg
atccgattcagtgagagcatccgggacggcgccatcaccttcagctgggtggagcagtcc
gccggagagaaacacgtccacgccgtggagccgtacaccaagaaggagctgtcggttctg
tctctgcccaacgccatctacaactacaccctgaccacggcggggcggagccacaacccg
ctggtctacctgtaccccgacacccccaaagacgccgcgttcgcgcgctacagagcggca
gagccgtctcctcccagcaggaacataaaggactacctctccaggaagatcactttggtc
tccattgaccccacgccgccgccgtctccgcccagagacatgccgatgacggacatggac
cttgagtaccccgaggtggatctgaacgacattctcaargatttagaggatttattggac
ctgcctgacctgttgcatgtccaccagtcgtctcctctggaaagcttcagtgatcctggt
ttctkgaatcaattcatcagtcagtga

DBGET integrated database retrieval system