KEGG   Poecilia reticulata (guppy): 103461355
Entry
103461355         CDS       T05149                                 

Definition
(RefSeq) suppressor of cytokine signaling 3-like
  KO
K04696  suppressor of cytokine signaling 3
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04120  Ubiquitin mediated proteolysis
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103461355
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103461355
   04920 Adipocytokine signaling pathway
    103461355
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103461355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pret04121]
    103461355
Ubiquitin system [BR:pret04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103461355
SSDB
Motif
Pfam: SH2 SH2_2
Other DBs
NCBI-GeneID: 103461355
NCBI-ProteinID: XP_008401882
LinkDB
Position
Unknown
AA seq 164 aa
MVTFSKNPAVNDDCFMVAKMQKQYHYKTFVSEDQFLMVLETLRGLRESDFYWSAITGKEA
GIVLSRQAPGTFLIRESSDRQHLFTLSVKTNTGTKNLRIVCEEDSFHLQTDPGNVEKAPR
FNCVLKLVDFYIRLGTSGFVYYINAGGERMPLMLVKPLYLSISP
NT seq 492 nt   +upstreamnt  +downstreamnt
atggtaacgttcagcaagaaccctgctgtcaacgacgactgctttatggttgccaagatg
cagaagcaataccactacaagactttcgtctcagaggatcagtttctgatggttctggag
acgttacgtggtctcagagagagtgacttttactggagcgccatcactgggaaggaggcc
ggcattgtcctgtccaggcaggcgcccggtactttcctgatccgggagagctccgacaga
cagcacctcttcaccctcagcgtcaagacaaacaccggcaccaaaaatctgcgcatagtc
tgcgaggaagactccttccacttgcaracggatcccgggaatgtggaaaaagctccccgt
ttcaactgtgtgctcaagctagtcgatttctatatccgactagggacatcgggttttgtc
tactacatcaacgctggaggggagaggatgcctcttatgctcgtcaaaccactctaccta
tccatttcacct

KEGG   Poecilia reticulata (guppy): 103481519
Entry
103481519         CDS       T05149                                 

Gene name
socs3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04120  Ubiquitin mediated proteolysis
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103481519 (socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103481519 (socs3)
   04920 Adipocytokine signaling pathway
    103481519 (socs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103481519 (socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pret04121]
    103481519 (socs3)
Ubiquitin system [BR:pret04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     103481519 (socs3)
SSDB
Motif
Pfam: SH2 SOCS_box RWP-RK
Other DBs
NCBI-GeneID: 103481519
NCBI-ProteinID: XP_008435239
UniProt: A0A3P9N845
LinkDB
Position
LG19
AA seq 208 aa
MSSVTPSESSRIQGSDLAPLHYKPFSSHEHYQQVIDAHRKLLESGFYFGPIGGLEAKASL
SKEEPGTFLIRDSSDRRYFFTLSVQTVYGTRNLRIHSEEGGFFLENDYQNKEKVPRFDCV
LKLITFYMGRGRDMQLTMDGVSEESMETIYLMDSRGIKTPLELLKPLKISPSSLKHICRR
ALNQTGQGEVQQLPQALRDFMKKYDASI
NT seq 627 nt   +upstreamnt  +downstreamnt
atgagcagtgtgaccccttcggagagcagcaggattcaggggtcagacttagccccactt
cactacaaacccttcagctcgcatgaacactaccagcaggtgatagatgctcatcggaag
cttctggagagcggcttttactttgggcccattgggggtctggaggccaaagcctcgctg
agcaaagaagaacctggcactttcctcatccgcgactcgtcggaccgccgctacttcttc
accctgtcagtacagacggtttatggaaccaggaacctgcgcatccacagtgaggaaggc
ggcttcttcctcgagaacgactaccaaaacaaagagaaggtgccgcggttcgactgcgtg
ctgaagctcatcacgttctacatggggagagggagggacatgcagctgacaatggatggg
gtgagcgaagaaagtatggaaaccatttacctgatggacagccgtgggattaaaaccccg
ctggagctgctgaagcccctcaagatcagcccctcgtccctgaagcacatatgcaggagg
gcgctgaaccaaacgggccaaggagaggtgcagcaactcccgcaggcgctcagagacttc
atgaagaagtacgacgcgtctatctga

DBGET integrated database retrieval system