KEGG   Poecilia reticulata (guppy): 103461716
Entry
103461716         CDS       T05149                                 

Gene name
g6pc2
Definition
(RefSeq) glucose-6-phosphatase 2 isoform X2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04068  FoxO signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103461716 (g6pc2)
   00052 Galactose metabolism
    103461716 (g6pc2)
   00500 Starch and sucrose metabolism
    103461716 (g6pc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103461716 (g6pc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103461716 (g6pc2)
   04920 Adipocytokine signaling pathway
    103461716 (g6pc2)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103461716 (g6pc2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 103461716
NCBI-ProteinID: XP_008402281
LinkDB
Position
LG2
AA seq 244 aa
MDFIHTSGVLIIQHLQNNYREYNSFLSFMSTVGDPRNIFYVYFPLWFHLSHNVGTKMIWV
AVVGDWFNLIFKWILYGQRPYWWVHETHLFQNSSKPYLDQFHITCETGPGSPSGHAMGSS
CVWYVMVTSALAFTRSSCVSSVWSFQRFHLLRSILWTAFWVIQISVCISRVFIATHFPHQ
VVLGLVTGMLVAEAFDHITWIYNASLKRQDVVCKPRLDPSRHHTLCRTMQEPGSLVWSRT
CGEL
NT seq 735 nt   +upstreamnt  +downstreamnt
atggattttattcatacatcaggtgtcctaattatacagcatctgcagaacaactacaga
gaatacaacagcttcctcagtttcatgtcaacagtgggtgaccctcgtaatattttctat
gtctatttccctctctggttccatctcagccataatgttggcactaagatgatatgggtg
gctgttgttggagactggttcaatcttattttcaagtggattctgtacggacagagacct
tattggtgggttcacgaaacccacttgttccagaacagctcaaagccatatctggatcag
tttcacattacgtgtgaaacaggacctggtagtccatctggtcacgctatgggctcatca
tgtgtgtggtatgtgatggtcacttctgctctagccttcaccaggtcctcttgcgtctcc
tctgtctggagctttcaaaggtttcatctcttgaggtccattctctggacagctttctgg
gtcattcagataagtgtttgcatttccagagttttcattgcaactcacttccctcatcaa
gttgttctcggtcttgtcactggtatgcttgttgctgaagcctttgaccacattacctgg
atctataatgcaagcctaaaacgccaagatgtggtgtgcaaacccagactggatccatct
agacaccacaccctttgccggactatgcaggaacctgggagccttgtttggtctaggact
tgcggtgaactctga

KEGG   Poecilia reticulata (guppy): 103481660
Entry
103481660         CDS       T05149                                 

Gene name
g6pc3
Definition
(RefSeq) glucose-6-phosphatase 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04068  FoxO signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103481660 (g6pc3)
   00052 Galactose metabolism
    103481660 (g6pc3)
   00500 Starch and sucrose metabolism
    103481660 (g6pc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103481660 (g6pc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103481660 (g6pc3)
   04920 Adipocytokine signaling pathway
    103481660 (g6pc3)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103481660 (g6pc3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 103481660
NCBI-ProteinID: XP_008435508
UniProt: A0A3P9P046
LinkDB
Position
LG19
AA seq 339 aa
MEALHTKGIWMAECLQQQTKNIEQFWLTVTHFGDPQVGFLFLFPLSYFVSNRLGVAVLWV
SALTEWLNLMLKWVLFGERPFWWVGECQLFFITKPRIFQFPCTCETGPGSPSGHAMVTAA
VWWVVVPPLSSFLHSRTHRWEISAAPYLIYGLLVGSVGLSRIFILAHFPHQVVTGIIAGI
FLGIFLGRRVPEGRPLLFFVSFSAGMLFSALILNVGLKLVGIDLLWTVTLAKKWCSRAEW
VRLDTVPFSALARDCGTLVGLGLAQNWNQSGWCTSTNHRALSLAVSFIGLYLVYSLPFPG
KSQDLFYCMVFVKFTLVPLTVMAVSPVLVHFFIRKMKKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaggcgttgcacaccaagggtatttggatggctgaatgtctgcagcagcagacaaag
aacatagagcagttctggctcaccgtcactcacttcggagatcctcaagtaggatttctg
ttcctattccctttaagttatttcgtgtctaatcgattgggagttgcggtgctgtgggtc
tcggccctgacggagtggttaaacctgatgcttaaatgggtgctgtttggagaaaggccg
ttctggtgggttggcgaatgtcaactatttttcatcacaaagcccagaattttccagttt
ccatgcacctgtgaaaccggcccaggcagtccgtcaggacacgcgatggtgactgctgca
gtctggtgggttgtggtgccccctctcagctcctttctgcactcccgcactcaccgttgg
gagatatcagctgctccctatctgatttacgggctgctggtgggttcagttggactatcc
aggatctttatccttgctcattttcctcaccaggttgttactggaatcattgcaggcatc
tttctggggatttttcttggccgtagagtgccagaagggcgccccctgttgttcttcgtc
agcttcagtgcaggaatgctgttcagtgctctgattctgaatgttggcctgaagctggtt
ggcattgatctcctctggactgtcactttggcgaagaaatggtgcagccgtgccgagtgg
gtccgcttggacacagtcccgttctccgccctggcccgggactgcgggacccttgttggt
ctggggctggcccagaactggaatcaaagcggatggtgtacgtcgacgaatcaccgcgct
ctgtctctggctgtttcattcattgggctgtacctcgtgtacagcctgccgttccctggc
aaatcacaggacctcttttactgcatggtcttcgtcaagttcaccctggtgcctctgact
gtcatggcggtcagtcctgtgctggttcactttttcatacgcaaaatgaaaaaggattag

KEGG   Poecilia reticulata (guppy): 103481693
Entry
103481693         CDS       T05149                                 

Gene name
g6pc
Definition
(RefSeq) glucose-6-phosphatase
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04068  FoxO signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103481693 (g6pc)
   00052 Galactose metabolism
    103481693 (g6pc)
   00500 Starch and sucrose metabolism
    103481693 (g6pc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103481693 (g6pc)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103481693 (g6pc)
   04920 Adipocytokine signaling pathway
    103481693 (g6pc)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103481693 (g6pc)
SSDB
Motif
Pfam: PAP2 DUF4181
Other DBs
NCBI-GeneID: 103481693
NCBI-ProteinID: XP_008435599
LinkDB
Position
LG19
AA seq 354 aa
MLTDIMDAVEGFGVSSTRYLQTNYKDAQGLFLWVSWAADLRNTFFIFFPLWFHLRPSVGI
KLIWVAVIGDWLNLVFKWVLFGERPYWWVHETAYYTDADRPHIEQYPMTCETGPGSPSGH
AMGAAGVYYTLVTSILAILTSKKSSNTNWYLKALLWSVFWGVQVCVCLSRVFIAAHFPHQ
VVAGVITGMIVAEAFNRTQWIYNASMKKYFYTTLFLTSFAVGFYVLLKAVGVDLLWTLEK
AQKWCVRPEWVHLDSTPFASLLRNMGTLFGLGLGLHSPLYTETKKSSSASARAGCILSSL
FLLHLFDSFKPPTHTAALFYLLSFCKSATVPLVTVSIIPYCVNRALSQHSKKGM
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctcactgatatcatggatgccgtggaaggttttggggtgagcagcacccggtacctg
cagaccaactacaaggacgcccagggcctgtttctctgggtgtcctgggcggcagacctc
aggaacaccttcttcatcttcttcccgctgtggttccacctgcggccctcagtcggcatc
aagctcatttgggtggctgttatcggagactggctgaacttggtgtttaaatgggttctg
tttggagagaggccgtactggtgggtccacgagacggcttattatacagacgctgaccgt
cctcacattgaacagtatccaatgacctgtgagaccggaccaggcagtccctccggacac
gctatgggagctgcaggagtctactacaccctcgtgacttccatcctcgccattctgaca
agcaagaaatcatcaaacacaaattggtatctgaaggctcttctgtggtccgtcttttgg
ggagtccaggtgtgtgtctgcctgtccagggttttcattgctgctcacttcccccaccag
gtcgttgctggagtcataacaggtatgattgtggccgaggccttcaacagaactcagtgg
atctacaacgccagcatgaagaagtacttctacacaacgctcttcctgacgagcttcgcc
gtgggcttctacgtgctactcaaggccgtgggtgtggacctcctgtggaccctagagaaa
gcccagaagtggtgtgtcagaccagagtgggtccacctggactccacgcccttcgccagc
cttctgcgcaacatgggcacgctgttcggcctcggcctgggcctgcattctccgctgtac
accgagaccaaaaagagcagcagtgcgtcagccagagcgggatgcatcctcagctctctg
ttcctgctgcacctgtttgactccttcaagcctcccacgcacactgcagccctcttctac
ctgctctccttctgcaagagcgcaaccgttcccctggtgaccgtcagcatcatcccgtac
tgcgtaaacagagctctaagccagcacagcaaaaaggggatgtga

KEGG   Poecilia reticulata (guppy): 103481694
Entry
103481694         CDS       T05149                                 

Definition
(RefSeq) glucose-6-phosphatase-like
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04068  FoxO signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103481694
   00052 Galactose metabolism
    103481694
   00500 Starch and sucrose metabolism
    103481694
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103481694
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103481694
   04920 Adipocytokine signaling pathway
    103481694
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103481694
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 103481694
NCBI-ProteinID: XP_008435600
LinkDB
Position
LG19
AA seq 396 aa
MGVRAENEQTGHSERELCRKWSLHVRQKETRLQLPLEVRGLSCGIMDILHSWGVELTSHL
QTRYSKYEGLFSLASAVADLHTTFFCLFPVWFYMRRDTGVRLIWVAVIGDWLNLVLKWVL
SGERPYWWVHETQFYGAGKAPSLQQFPITCETGPGSPSGHAMGVAGVWYVMVTAMLSIAK
EKQCPSVLYSLLQISLWTLMVVVVLIVCMSRVFMAAHFPHQVIEGVFTGIVVAGMVSKKK
WIYRASMSKYLLITLFLTFFAIGFYLLLKIVGVDLLWTLDKAQKWCIKPEWIHLDTTPFA
SLLRNMGSLFGLGLGLHSPFYHGIKKNANAGFKMGCIMIALFLLHLLDGWTFSPDNHMTF
YILSFGKSAFALLIPTTLIPWALCRICKGMELDKNL
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgggggttcgcgcagagaacgagcagacaggacattctgagagggagctttgcagaaag
tggtccttgcacgtaagacaaaaggagaccagattgcagctaccgctcgaggtccgaggt
ctgagttgcggtatcatggatatccttcacagctggggggttgagctgaccagtcatctg
cagaccagatacagcaagtacgagggtctgtttagcctcgcctccgccgtggccgatctg
cacaccacgttcttctgcctgtttcccgtgtggttctacatgcgcagggacacaggggtc
aggctaatctgggtggctgtcattggagactggctcaatttagtcctgaaatgggttctt
tctggagagaggccctactggtgggttcatgagacccagttttacggggcaggaaaggcc
ccatcgctgcagcagtttcctatcacatgtgaaactggaccaggaagcccttcgggtcat
gctatgggtgtagctggtgtctggtatgtgatggtcaccgctatgctttcaattgcaaaa
gaaaagcaatgcccctctgtattatacagcttgctgcagatcagcttatggaccttaatg
gttgtggtggtgctgatcgtctgcatgtccagggttttcatggcggctcacttcccacat
caagttattgagggggtcttcacaggcatagtggttgctggtatggtttccaagaagaag
tggatttacagagccagcatgagcaaatacctcctcatcaccctcttcttgactttcttc
gctattggcttctacctgctgcttaaaattgtcggcgtggacctgctttggaccctggac
aaagcccagaaatggtgcatcaagccagagtggatccatctggacaccacgcccttcgcc
agcctcctacgtaacatgggtagtctgtttggtcttggactgggactgcactctcccttc
taccatggcatcaagaagaacgcaaatgctggtttcaagatggggtgcattatgatcgcc
ttgttcttgcttcatctcttggatggatggacgttttccccagacaaccacatgactttc
tatatcctatcttttggtaagagtgcttttgcacttttaatcccaaccactttaattcct
tgggctctttgtaggatttgcaaaggaatggagttggataagaacttgtga

DBGET integrated database retrieval system