KEGG   Poecilia reticulata (guppy): 103461729Help
Entry
103461729         CDS       T05149                                 

Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00052  Galactose metabolism
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103461729
Enzymes [BR:pret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     103461729
    3.2.1.108  lactase
     103461729
Chaperones and folding catalysts [BR:pret03110]
 Intramolecular chaperones
  Others
   103461729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 103461729
NCBI-ProteinID: XP_017164845
LinkDB All DBs
Position
LG2
AA seq 1663 aa AA seqDB search
MLLAGPLTEKNHRTSSSEENVFDCSHPIPAASKQYFKYLQTKGVTHFKVPLSWAKLLPMG
LTSKPQQAVKRCYHTLLKNLQEEGLQPLIILHGSTVPEYLRSRYGGWESQQLLDMFQQYA
EFALREFGQMANSWVTFSDLDEILREGHAVDGHTPLQNILQLNKKIHEFYHQNFPYEGRR
LSFGLNPKHVDQLSNLKAFXNVDFLSVNLEYNCASSKSFAQELRNLKTSTGNLPILLYKM
PVRDCIPSEHQLLGDLLQVLWSNSLNIMGCDMKNVLDELDMQDSPVSRPEFKKSHKNILH
KFGDQASDDKDLFLTKAFPLGFQWATSSESFKVEGGWLEGGKGETIWDRFGHEGQAFANH
TADLACDSYNKVDIDVYLLRGLGVNTYQFSISWARIFPSGYKDSLKEEGALYYDNLINAL
IESGIQPVATIYHWDLPQALQDNGGWTNXSIVAXYTDYAAFCFHRYGNRVKSWNTFSSPW
VVSHAGYGTETNYLAVNNVPIYITGNGMPTDDSGDTLNDVSRIAYMRGYISEALKAIELD
KVDVQRFTVQSLMDGFEGNKGYSERFGLHQVNFVDGYRPRTPKQSAYFFAQIIEQNGFVS
QKQDHFEGVKISPPRRSTPLPPSDVPSASKVVWEKFTPQKKFDRQMYHYGNFSQDFLWGV
SSSAYQIEGGWNAEGKGPSVWDTFTQKPGSGIPEDANGNEACDSYKRLDEDIYMLQALKV
KTYRFSLSWSRIFPNGRRASLNQKGVDYYNRLIDGLLVKKITPMVTMYHWDLPQALQDIG
GWQNVEMIDIFNDYSDFCFATFGDRVKFWMTMNDPQGLAWLGYGTGQIPPNIKEPGTAPY
QVAHNLIKAHATAYHTYDEKYRASQRGMISIALNAEWVEPKDINVPRDLVAADRAMQFHV
GWFAHPIFKNGDYPEAMKAQVLVKSELQSLSQSRLPSFTDEEKNLIKGTADMFCVNHYTT
RJVTHITGLLSPHSYQNDWDFTEEQESGSPATAIKNQRAVSWGLRRLLNWIMKEYGDPEI
YITDNGGATTAKTSWDDIDRVLFYKTYINEALKAYELDGVMLKGYTATSLMDSFEWLNGY
TVGFGFYHVDFTDPNRPRTPKLSAHFYFQLMKDNGFPITEDEKMLYGEFPQDFLWSSATA
AYQIEGGWRADGKSLSIWDKFAHTPLKIFDSDNGDIACDSYNKIDEDIAILKQLGVNHYR
FSISWTRVLPDGTTNHINEVGFRYYBRLVDALLAANIQPHVTLYHWDLPQALQNVGGWEN
DTIVQRFRDYADVMFSRLGDRVKLWITINEPYNVAMIGHGYGVAAPGISFRPGTLPYIVA
HNLIKAHAEAWHLYNDKYRGRQNGKVSITINSDWSEPRNPYKQEDIDAARRIIQFYIGWF
AHPIFNGDYSEMMKTIIRERSLAAGLTKSRLPEFTPEEIKRIKGTHDYFGFNHYTTVLAF
PVEYGNLQHYDADRGAGTYVDRSWLDSGSGWLKITPFGLRRILNFIKEEYGNPTIIITEN
GVSERGPTDLKDSHRSYFYEKYINQVLKAYRLDNVDVRGYTAWSLMDNLEWATGFSERFG
LFYVNRSDPNVPRVAKESVSFFSTIINCNGFPDPASGPHDCLKPKPEATNAPENDNSVNF
LGLKLSAEEAETGLNTTFALLLVAATGAICLSIGCFVTKRCSK
NT seq 4992 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttgctggccctctgactgagaagaatcacagaacctccagcagtgaggaaaat
gtctttgactgcagtcatcccataccagcagcttccaagcagtattttaagtacctccag
accaaaggagtgacccacttcaaagtgccgctgtcatgggcaaaacttcttcctatgggc
ctgaccagcaagcctcaacaggctgtgaaaaggtgttaccataccctgctgaagaacctg
caggaggagggcttgcagcctctcatcattcttcatggatcaacagttccagagtatttg
aggtccaggtatggaggctgggaaagtcagcagctgctagacatgtttcagcagtatgct
gagtttgctttgagagaatttggccaaatggcaaactcatgggtgacatttagtgacctg
gatgagattttgcgtgaaggacatgctgtagatggtcacactcctctccaaaatatcctt
cagctcaacaagaagattcatgagttttatcatcaaaactttccatatgaagggagacgt
ctatcatttggcctgaatccaaaacatgtggatcaactttccaatcttaaagctttcasa
aacgtggatttcttatccgtgaatcttgaatataactgtgcctcctcaaagagttttgca
caagagttgagaaacttgaagacatctactggaaatttgccaatcttgctatataagatg
ccagttcgtgactgtatcccaagtgaacaccagcttcttggagatttattacaagtttta
tggagcaacagtctgaatattatgggatgtgacatgaagaatgtgttggatgagttggac
atgcaggattctccagtcagcagacccgaattcaagaagagtcataaaaacatcttgcat
aaatttggagaccaagccagcgatgataaagatctgttcctcactaaagcctttcccctg
ggcttccaatgggcaacgtcatcagaatctttcaaggttgaaggtggttggttggaaggg
ggaaaaggagagactatttgggatcggtttggtcatgaaggtcaagcttttgcaaatcac
actgctgatcttgcttgtgacagttacaacaaagttgatatagatgtctacctcctgcga
ggtcttggagtcaacacctaccagttctccatttcctgggcccgtatattcccctcaggy
tacaaagacagcctgaaggaagaaggagctctctactatgacaatctgatcaatgctctt
attgaatctggcatacagcctgtygccactatctaccattgggatctrcctcaggctctc
caagacaatggtggatggaccaacycttccattgttgcagyttacacagactatgcagcc
ttctgcttccatagatatggaaacagggtcaagagctggaacacattcagtagtccctgg
gtggtgagccatgctggatatggcactgaaacaaattatctagccgttaacaatgtgccc
atttacataactgggaatggcatgccaacagatgacagtggagacaccctgaatgatgtt
agtagaattgcgtacatgagaggttacatcagtgaggccctaaaagccattgaactcgat
aaagtggatgtgcagcgattcacagtgcaatcacttatggatggatttgagggaaataaa
gggtacagtgaaagattcggacttcaccaggttaattttgtagatggatacagaccaaga
acaccaaaacaatcagcatatttctttgctcagatcattgagcaaaatggttttgtttca
caaaaacaagatcattttgaaggtgtgaaaatatcaccacctcgccgctccaccccactg
ccaccctcagacgtcccatcagcatcaaaagttgtctgggaaaaatttacgccacagaaa
aagtttgacagacaaatgtatcactatggcaatttctcacaagacttcttatggggcgtc
tcatcttcagcttaccagattgagggtggatggaatgcggaggggaaaggacccagtgta
tgggatacatttactcagaagccaggtagtggtattcctgaagatgcaaatggcaatgaa
gcctgtgacagttacaaaagacttgatgaagacatttatatgctgcaagcactgaaggtg
aagacctacagattttctttgtcatggtccagaatctttcccaatggtagacgtgcatcc
ctgaaccaaaagggtgttgactactataacagactaattgatggtctcttagttaagaaa
atcaccccaatggtcaccatgtatcactgggayctcccacaagctctacaagacattggt
ggctggcagaatgtagagatgattgacatttttaatgattatagtgacttctgctttgcc
acctttggtgacagagtaaaattctggatgaccatgaatgaccctcaaggacttgcatgg
ctaggatatggaactggacaaatccctccaaacattaaggagccaggaacagcaccatac
caagttgcacataacttaataaaagctcacgctacagcataccacacatatgatgagaaa
taccgcgcttctcaaagaggtatgatttccattgccctcaatgctgaatgggttgaacct
aaagatatcaatgttcctcgtgatcttgttgctgctgaccgtgcaatgcagttccatgtg
ggttggtttgcccacccgattttcaagaatggggaytatccagaggccatgaaagcccaa
gttttagtcaaaagtgaactccaaagtctttcgcaatcaagactcccttctttcacagat
gaggaaaagaacttgatyaaaggaactgctgatatgttttgtgtgaatcactacaccaca
aggwtagtaacccatatcacaggtctgctgtctccacattcctatcaaaatgactgggac
ttcacagaggaacaagaaagtggttcaccagctacagccatcaaaaaccagagagctgta
tcatggggcctacggagactcttgaattggatcatgaaagagtatggagaccctgaaatt
tacataactgataatggtggggctacaacagcaaaaacctcttgggatgacattgacaga
gtgttgttttacaagacttacatcaatgaagctcttaaagcttatgaactagacggagta
atgctaaaaggctacacagcaacatctctcatggactcctttgagtggttaaatggctat
acagttggctttgggttctaccatgtcgactttactgacccaaacagaccaagaacaccc
aagttgtcagctcatttttactttcaacttatgaaagacaatggtttccccataacagaa
gatgagaagatgctgtatggagagttccctcaggatttcctttggagtagtgccacggca
gcttaccagattgagggtggatggagagctgatggaaaaagtctcagcatctgggataaa
tttgctcacacgccactcaaaatctttgacagtgacaatggggacattgcttgtgacagt
tacaataaaatagatgaagacattgcaatattgaagcaacttggcgttaaccattatcgt
ttctctatatcctggacgcgggtacttcctgatggcacaacaaatcacatcaacgaggtt
ggatttcgctactatracagattggtggatgcgctgcttgctgcaaacatacagccgcat
gtaactttgtaccactgggatcttccacaagctctgcagaatgtgggaggttgggagaat
gacactattgtycaamgattcagggattatgctgacgttatgttcagtcgtcttggagat
agagtgaaactttggatcaccattaatgagccctataacgtagcaatgattggacatgga
tacggagtagccgccccaggtattagtttccgtccaggtactcttccctacatcgttgct
cataaccttatcaaagctcatgctgaagcatggcacctttacaatgacaaatatcggggt
agacagaatggaaaagtctctatcactatcaactctgactggtcagagcccagaaacccc
tataagcaagaggacattgacgcagcaagacgtataatacagttctacattgggtggttt
gcccatcccatatttaatggtgactacagtgaaatgatgaagacaatcattcgggaacgc
agtcttgcagctggattgactaaatcacggctacctgaatttaccccagaggaaataaag
agaattaaggggacccatgattattttggattcaaccattacaccactgtcctggcattc
cctgttgagtatggaaatcttcagcattatgatgcagataggggtgcagggacatatgtt
gatcgttcctggctagattctggttctggctggctgaagatcacgccatttgggttgcgc
agaatattgaactttattaaggaggaatatggaaatcctacgattatcatcactgagaat
ggggtctcagagcgtgggcccacagatcttaaagactctcacaggagttacttttatgaa
aaatatattaaccaagtactgaaagcttaccggcttgataatgtggatgtccgtggctac
acagcatggtcactcatggacaacctggagtgggccactggcttctcagagagatttgga
cttttctatgtcaatcgctctgatcccaatgtgcctcgagtggccaaggaatctgtgtct
ttcttctccaccatcatcaactgcaatgggtttcccgaccctgcatcaggacctcacgat
tgtttgaagcccaaacctgaagcaacaaatgctccagaaaatgacaattcagtgaacttt
ctgggtctgaagctctccgctgaagaagctgaaaccggacttaacactacatttgctctg
ctgcttgtggcagcaactggagccatttgtttgtccatcggttgctttgtcactaaaaga
tgttcaaaataa

DBGET integrated database retrieval system