KEGG   Poecilia reticulata (guppy): 103461959Help
Entry
103461959         CDS       T05149                                 

Gene name
ercc5
Definition
(RefSeq) DNA repair protein complementing XP-G cells
  KO
K10846  DNA excision repair protein ERCC-5
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    103461959 (ercc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pret03400]
    103461959 (ercc5)
DNA repair and recombination proteins [BR:pret03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     103461959 (ercc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 103461959
NCBI-ProteinID: XP_008402595
LinkDB All DBs
Position
LG3
AA seq 1089 aa AA seqDB search
MGVHGLWRLLESTGKPINPETLEGKILAVDISIWLNQAVKGVRDREGNSVQNAHLLTLFN
RICKLLFFRIRPVFVFDGDAPMLKKQTLALRRQRKEELTTQSKQTNEKLLKTFLKRQAIK
AALGDHSKEPLPSLSSVKRNEVDDMYVLPALPPTEEKERSSSEEDEEERASEEMVETYQE
ELYEDPNSVDMNSEDFTSLPPEMKHEILKEMKEFCKRRRTMFNKPPERSGDFSQYQLAGL
LQRNRLNQRLEGVEKEMSQRSAGSAPQLGQQDEDEQNRSVESRRLVSEDNSHYILIKGSK
KNEQASQSQPAAAPWTSSRKRKADKPEPLWRPIAEDDEEEDVRPTCSDAVNPPVSKPLQP
PSPRTLKAIQAAMSDGSDEEKLNPDSKDGKVSPRTLLAIQQALTEDEVSVSPSKLQTSPQ
RPARRVVISNSDEETEPSLKEESDFSQSAARIKDSLLGSSSEDELGEVIGERNKAFRFAA
LRQSPTTAMESEVERVREAEKQKELEPREPEHKLHASQSSQELSISSPSLESAKRASTET
EQRLLDKSKDRLTAGPAKNDGDDVKSENSQQESDSEESFIEVSEEEFKQEEANDSAGEKR
ILEEVQEDETKTEEESEESLTQATGHPALSSDKEDEEEGEQRKAQEKEAKDDMESKPTAE
NNEWEHLDMDELEALESSLQLEQSSLREQKQQQERMANTVTGQMYLESQELLRLFGVPFL
VAPMEAEAQCAALDRADQTNGTITDDSDVWLFGGRHVYRNFFSQNKYVEHYQYSDLQSQL
GLDRTKMINLAYLLGSDYTEGVAGVGYVTGMEILNEFPAPGLEPLIQLSNWWCEAQEKKR
LTDNPRDTKVKKKLRELKLQPGFPNPAVAQAYLQPAVDQSQASFSWGRPQLDMIKEFCLS
RFGWSSRKTEETLQPVIKQLNNQQTQLRIDSFFRLEQQEKQSIRSQRLRRAVTCMKRKER
EGGEGDSSEEELPSPSKSRKGNLKNTEGQKEEEPPVTGGGFLAPKSNSESPSTPLRDFCS
PGQESFTATAADQSTKKLPQKASRKSSSSGSGEDSDEGSAVAMVTARSVFEANRRGRGGK
RPRGRGKKL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgcatggactctggagactcctggagagtacaggaaaacccatcaaccccgag
acactggaaggaaagattcttgctgttgacatcagtatatggctgaaccaggcagtgaag
ggggtgagggaccgtgaaggcaacagcgtccagaacgcccacctcctcactctgttcaac
cgcatctgtaagctgctcttttttcgcattagaccggtgtttgtgtttgatggagatgct
cctatgctgaagaagcagaccctggctctgaggaggcagaggaaagaggaactgaccact
cagtccaaacagaccaatgagaaacttctgaagacgttcctgaagagacaagccatcaaa
gctgctcttggagatcatagtaaggaacctctaccaagcctctccagtgtaaaaagaaat
gaagtggacgacatgtatgtcctacccgcccttccacccacagaggaaaaggaaagaagc
agctcagaggaggatgaggaggagcgagcaagcgaggaaatggttgaaacataccaggaa
gaactgtatgaggacccgaactcggtggacatgaactctgaggattttaccagcctgcct
cctgagatgaaacacgagatactcaaagagatgaaagaattctgcaaaagacgtcggacc
atgtttaacaaacctcccgagcgttccggagacttttcgcagtaccaactggccggcctg
ctgcagaggaaccggctaaaccagcgcctggagggagttgagaaggagatgagccagcgc
agcgctggcagcgctccacaactcggtcagcaggatgaggatgagcagaatcgcagcgtg
gagtcaaggcggctggtttcagaagacaactcgcactatatacttataaaaggctccaaa
aaaaatgaacaagcctcacagagccaacctgcagctgcaccctggacaagttctaggaaa
aggaaagctgacaaacccgagcctctctggcgacccatcgctgaagacgatgaagaggag
gatgtacgacccacctgctcagacgccgtcaacccacctgtgtcaaaaccattgcagccg
ccttcgcctcggacactcaaggcaatccaggctgctatgagcgacggctcagatgaagag
aagctgaatccagatagcaaggacggcaaagtctctccacggacactcctcgcaatccag
caggcattaactgaggacgaagtaagcgtctcaccgtccaaactgcagacaagtccccag
cgccctgcgcggcgagtggtgatcagcaattctgatgaggagacggagccttcacttaag
gaagagtcggacttcagtcaaagcgccgcacgcatcaaagacagtttgctgggcagcagc
tctgaagatgagctgggtgaagttattggagagagaaataaagcttttcgctttgcggca
cttcgacaaagtcccacaactgcgatggagtcagaggtggagcgcgtaagggaagcggag
aaacaaaaagagctggagccgagagaacctgagcacaagctgcacgcttctcaatccagt
caggagttatccatcagctctccatcacttgaaagtgcgaaacgggccagcactgagacg
gagcagaggctcctagacaagagcaaggatagactcaccgcaggcccggcaaaaaacgac
ggagacgacgtcaagtcagagaacagccagcaggaaagcgactcagaagagagcttcatt
gaggtgtccgaggaagaatttaagcaggaggaagcaaatgattcagcaggagaaaagagg
attttagaagaggtgcaggaagatgagacaaaaactgaagaagagtccgaggaaagtttg
actcaggccactggtcatccagctctgagctcagacaaggaggatgaggaggagggagag
cagagaaaagctcaggaaaaagaggcgaaggacgacatggaatccaaaccaacagcagaa
aacaacgagtgggaacaccttgacatggacgagctggaggctctggagagctcgctgcag
ctggagcagagcagcctgagggagcagaagcagcagcaggagcggatggcgaacacagtc
acagggcagatgtacctggagagccaggagctgctgcggttgttcggcgtgccgttcctg
gtggctcccatggaggccgaggctcagtgcgcggcgttggaccgcgccgaccagacaaac
gggaccatcacagacgactctgacgtgtggctgtttggaggacgacatgtttacaggaac
ttcttcagccagaacaaatatgttgagcactaccagtacagcgacctgcagagccaatta
ggtctggacagaacaaagatgatcaatctggcttatctgcttggaagtgactacacagag
ggtgttgcaggagtgggatatgttactggcatggagatactgaacgagtttccagcgccg
ggactggagccactaatacagcttagtaattggtggtgtgaagctcaggagaagaagcgt
ctgaccgataatcccagagatacgaaggtgaagaagaagctgagggaactgaaacttcag
cctggcttccccaaccctgcggtggctcaggcttacctccagcctgccgtcgatcagtcc
caggcctccttcagctggggccgcccgcaactcgacatgatcaaagagttctgtctcagt
cgttttggctggagcagcagaaagacggaggagactctccaacctgtgatcaaacagctc
aacaaccagcagactcagctccgaatagactcattcttccgcttggagcagcaggaaaag
cagtcgatccgcagccagcgactccgccgagccgtcacctgcatgaagagaaaggagagg
gaaggaggggaaggtgacagcagtgaagaagaactgccttctccatccaaatccaggaaa
ggaaatctaaaaaacacagaaggacagaaagaagaggagccccctgtgacaggtggaggt
ttcttagctccgaagtcgaattctgaatctccttctacacctctcagggatttctgtagt
ccaggtcaggaatccttcacagcaacagctgctgaccagtctactaaaaaactacctcag
aaggccagcaggaagagcagcagcagcggctccggtgaggatagcgacgaaggcagtgcc
gttgctatggttacagcccgatctgtgtttgaggccaacagacgaggccgaggaggaaaa
cgcccaagaggaagaggaaagaagctttaa

DBGET integrated database retrieval system