KEGG   Poecilia reticulata (guppy): 103462287
Entry
103462287         CDS       T05149                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04068  FoxO signaling pathway
pret04110  Cell cycle
pret04115  p53 signaling pathway
pret04218  Cellular senescence
pret04310  Wnt signaling pathway
pret04340  Hedgehog signaling pathway
pret04371  Apelin signaling pathway
pret04510  Focal adhesion
pret04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103462287 (ccnd1)
   04340 Hedgehog signaling pathway
    103462287 (ccnd1)
   04371 Apelin signaling pathway
    103462287 (ccnd1)
   04068 FoxO signaling pathway
    103462287 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103462287 (ccnd1)
   04115 p53 signaling pathway
    103462287 (ccnd1)
   04218 Cellular senescence
    103462287 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103462287 (ccnd1)
   04530 Tight junction
    103462287 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103462287
NCBI-ProteinID: XP_008403196
UniProt: A0A3P9MZK8
LinkDB
Position
LG3
AA seq 292 aa
MEEQLLCCEVDSIRRAHQDENLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGAACMFLASKMKETVPLT
AEKLCIYTDNSVLPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIHPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSPNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHGSVAETKRMDEDVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggagcagctgctgtgctgcgaggtggactctatcaggagagcccaccaggacgaa
aacctacttaatgaccgagtcctacagactatgctgaaggcagaggagaactacctaccg
tcccccaactacttcaagtgtgttcagaaagagattatacccaaaatgaggaaaatacta
gccacttggatgttggaggtctgcgaagagcagaagtgcgaggaggaggtttttccactg
gcgatgaactatttggacagatttttatcagtggaggccaccaggaaaacaagactgcag
ctgctaggagcagcctgcatgtttctagcatccaagatgaaggagactgtccccctcact
gcagagaagctctgcatctacacggacaactcggtcctacccggggagctgctgcaaatg
gagctgctggttctcaacaagctcaagtgggacctggcttcagtcactcctcatgacttt
attgagcacttcctgtccaagttgaagattcacccctccacaaagcagatcctcaggaaa
cacgctcaaaccttcgtggcgctctgcgcaacagatgtcaactttattgctagtcctcca
tcaatggtagcagcaggaagtgtagtggctgctgttcaaggtctctacctgaaaagccaa
gatgcctccctctcctcaccaaacctcaccaacttcctgtcacaggtcattcgcagtgac
ccggactgtctgcggtcgtgtcaggagcagatagagtcgctgttggagtccagtctgcgg
caggctcagcagcacggcagcgtagcagaaaccaaacgcatggacgaggacgtcgacctg
tcctgcacgcccacagacgtgagagacgtcaacatctga

DBGET integrated database retrieval system