KEGG   Poecilia reticulata (guppy): 103462543
Entry
103462543         CDS       T05149                                 

Gene name
tradd
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04210  Apoptosis
pret04217  Necroptosis
pret04622  RIG-I-like receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103462543 (tradd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103462543 (tradd)
   04217 Necroptosis
    103462543 (tradd)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103462543 (tradd)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103462543 (tradd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103462543 (tradd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103462543 (tradd)
SSDB
Motif
Pfam: TRADD_N Death
Other DBs
NCBI-GeneID: 103462543
NCBI-ProteinID: XP_008403636
LinkDB
Position
LG3
AA seq 323 aa
MRGQEVSSMSNSNLSGGSTAEQHKSFFSFEKMADKTADGGAWTGCAVMFLQSLFPGVDLL
ALYKGEQGKFIIFKVIKLTLRDSAGGLGGYEILKVHDAEPFLGVEVKFVDVAACQQFLES
YSSGAVLQSLNQHACRLLGLTQDFTVRTQLKAGHQNLDLCLDQLAVCLQHIHLSQPERLR
DEEIDHLEQQLQSQALGPAPQPPTVTQEESPVPSNCFKFQNRVFEDRMLTAADVQSFSNG
VGRQWKHVGRALGKSCRALKGPAIDNLAYEYEREGLYEQAYQLLSRFIQAEGRAAKLSRL
VRALEDSKLTSLAENMLGMQPRE
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagaggccaggaagtcagttctatgtcaaacagtaatttgtcaggaggaagcactgcc
gaacaacataaaagttttttttcttttgagaaaatggcggacaagacagcggatggaggg
gcgtggacgggatgtgccgtcatgttcctgcagtcgctctttcctggcgtggacctgctc
gctctctacaaaggcgagcaggggaagttcatcatcttcaaagtcatcaagctgactctg
agagattctgcaggaggtctgggaggctacgagatcctaaaggtccatgatgctgagccc
ttcctgggggtggaggtgaaattcgtggatgtggcagcgtgtcagcagttcctggagagc
tacagctccggagcggtgctccagtccctcaaccagcacgcgtgccggctgctcggcctt
acccaagacttcaccgtgcgaacccagctgaaggccgggcatcagaacctggatctgtgt
ctggaccagctggctgtctgtctgcagcacatccacctttcacagccggagcgcctgcgt
gacgaagagatcgatcatctggagcagcagctgcagagccaggcgctgggtccggcccca
cagccccctacggtcacacaggaagagtctccagtgcccagcaactgcttcaagtttcag
aacagagtgtttgaggaccgaatgctgacagcggcagatgttcagagcttttcgaacgga
gtgggccgtcagtggaaacacgtagggagggccctggggaagagctgtcgtgctctgaag
ggccccgccattgacaacctggcctacgagtacgagagagaagggctgtatgagcaagcc
tatcagctgctgagccgcttcattcaggcggaggggagggcggccaagctgagccgactg
gtcagagctctggaggacagcaaactcaccagcctggctgaaaacatgctgggcatgcag
ccccgagagtaa

DBGET integrated database retrieval system