KEGG   Poecilia reticulata (guppy): 103462793Help
Entry
103462793         CDS       T05149                                 

Definition
(RefSeq) putative trypsin-6
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103462793
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pret01002]
    103462793
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103462793
Enzymes [BR:pret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103462793
Peptidases [BR:pret01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103462793
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103462793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 103462793
NCBI-ProteinID: XP_008404009
LinkDB All DBs
Position
LG3
AA seq 251 aa AA seqDB search
MALLKVLLLLGLCVSVNSGVSLQKRIIGGQNCDNGERLYHVRLESSNGTHMSRCGGSLIH
PKWILTSTLCWMSGWTNVAMLKVHPRTAIHSVYNQVIRHNPVIYTHGGHXHGIMLLKLQT
PVTDIPVVQLPDCRRRLKIGDVVQLAGEGGTTTGPNNRRMPPGAPIPVHLQCVDMNVAHV
SLVVPSRGFLFYAVKPNKDICYGDCGGAVMYNGKIYGVIAFGGEDACQSPVEIMDVCQYK
DWIKRTIRHGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgaaagttctgctgctgctggggctgtgtgtttcagtgaactcaggtgtt
tctctgcagaagagaatcattggaggtcaaaactgtgataacggggagcgtctttatcat
gttcggctggagagcagcaatggtactcatatgagccgctgtggaggatctctgatccac
cctaagtggatcctgacttcaactctctgctggatgtcaggatggactaacgtagcaatg
ttaaaagttcatccacggacggctatacattccgtgtacaatcaggtaattcgacacaat
cctgtgatttatactcatggcggccacyagcatggcatcatgttactgaagcttcagaca
ccagtaacagatatcccagttgttcagctaccagactgcaggcgtcgtcttaaaataggt
gatgttgttcagctggcaggagaaggaggaacgacaaccggccccaataatcggcgaatg
ccccctggtgctcctattccagtacatcttcagtgtgttgacatgaatgttgctcatgtt
tccctcgttgtgccgagtcgtgggtttttgttctatgctgtaaaaccgaacaaggatata
tgctatggtgactgtggtggagcagtgatgtacaacggcaagatttatggtgtgattgct
tttggtggagaagatgcatgtcagagtccagttgaaatcatggatgtgtgtcaatacaag
gactggattaagagaacaattaggcatggaaaataa

DBGET integrated database retrieval system