KEGG   Poecilia reticulata (guppy): 103462839Help
Entry
103462839         CDS       T05149                                 

Definition
(RefSeq) N-lysine methyltransferase SMYD2-A-like
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00310  Lysine degradation
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103462839
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pret03036]
    103462839
Enzymes [BR:pret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     103462839
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     103462839
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103462839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12 TPR_8 TPR_10
Motif
Other DBs
NCBI-GeneID: 103462839
NCBI-ProteinID: XP_008404070
LinkDB All DBs
Position
LG3
AA seq 424 aa AA seqDB search
MVHPDRGRGLRAVRHFAVGELVFACPAYSYVLTVNERGAHCEHCFTRREDLFKCGKCKQA
YYCNVDCQRGDWPMHKLECVAMCAYGENWCPSETVRLVARIIMKQRVTTDRTPSERLLLL
KEFEAHLDKMDSEKEELNQADIAALHHFYSKHISDLPDDQALTELFAQVNCNGFTIEDEE
LSHLGSAVFPDVALMNHSCSPNVIVTYKGTVAEVRAVQEINPGEEIFDSYIDLLYPTEDR
RERLLDSYFFMCQCTECTSRSKDKAKMEIRKLSSPPEPKEIQSMVHYAKNVIEEFRRAKH
YKNPGELLEMCELSLEKMGAIFADTNVYMLHMMYQAMGVCLYMQDWDGAMSYGEKIVQPY
SVHYPTYSLNVASMYLKLGRLYLGLEKKSQGVKALKKALAIMEVAHGKDHHYVAEVKREI
LDQK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtacacccggaccgaggccgaggcctgcgggcggtgaggcacttcgcggtgggggag
ctggtgttcgcctgtcctgcctactcctacgtgctgacggtgaatgagaggggggctcac
tgcgagcactgcttcaccaggagagaagatcttttcaaatgcggtaaatgtaagcaggcs
tactactgcaatgttgactgtcagagaggcgactggcccatgcataagctggagtgtgtc
gccatgtgtgcatatggggagaactggtgtccatcagagacggtcagactggtggccaga
atcatcatgaaacagagagtcacgacggatcggaccccttcagaacggctgctcctgctc
aaagagttcgaagcacatctggataagatggacagtgagaaggaggagttaaaccaggct
gacattgcggctttgcaccatttctactccaaacacatcagtgacctccctgacgaccag
gctctgactgagctctttgcacaggtaaactgtaatgggttcaccatagaggacgaagag
ctctcccatctaggatcagctgtttttcctgatgtagcgctgatgaaccacagctgtagt
ccaaatgttattgtgacctataaaggcacagtggctgaggtcagagccgttcaagagata
aacccaggggaagagatctttgacagttacatagacctgctgtatccaacagaggaccgg
agagagaggctgttagattcctacttcttcatgtgccagtgcaccgagtgcaccagcagg
tcaaaggataaagcaaaaatggagatcaggaagctgagctctccgccagaaccaaaggaa
atccagtctatggtccattatgccaaaaatgtcattgaagagttcagaagagccaagcac
tacaaaaatcccggcgagctgctggagatgtgtgagctcagcctggagaagatgggagct
atttttgcagacaccaacgtctacatgctgcacatgatgtatcaggccatgggcgtgtgt
ctctacatgcaggactgggacggcgccatgagctacggggagaaaatcgttcagccgtac
agtgttcactacccgacctactctctcaatgtggcgtccatgtacctgaagctgggccgt
ctctacttgggacttgaaaagaaatctcaaggtgtcaaagctttgaaaaaggcgttggcc
atcatggaggtggctcatgggaaagaccaccattatgtagcagaggtcaaacgggaaatc
ctggaccagaaataa

DBGET integrated database retrieval system