KEGG   Poecilia reticulata (guppy): 103463575
Entry
103463575         CDS       T05149                                 

Definition
(RefSeq) retinoic acid receptor RXR-gamma-B-like isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103463575
   03320 PPAR signaling pathway
    103463575
Transcription factors [BR:pret03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103463575
Nuclear receptors [BR:pret03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103463575
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 103463575
NCBI-ProteinID: XP_008405220
LinkDB
Position
LG4
AA seq 501 aa
MDSNDPYLHLSPWGMAEPCGWESTERRKPMVQKEQSRPPSGASLIRCCKFLRNSAGPMSA
GHVHPPSMAGMVGHPSVISTSRPLPSPMSTLGSPMNGLASPYPVITSSLGSPSVPLQSTP
NMNFGAISSPQMNSMNSVSSSEDIKPPPGLQSLGNINYQCTSPGGMSKHICAICGDRSSG
KHYGVYSCEGCKGFFKRTVRKDLTYTCRDSKECLIDKRQRNRCQYCRYQKCLAMGMKREG
VGVCAAVQEERQRGKERGENEVESTSSFNDDMPVEKILDAELAVEPKTETYSDGSPGNST
NDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSVTVK
DGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKTELGCLRAIVLFNPDAK
GLSNPSEVEALREKVYASLESYTKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKL
IGDTPIDTFLMEMLEAPHQIT
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggacagcaatgatccatatttacacctgagtccttggggaatggcagaaccatgtgga
tgggaaagcacggagagaaggaaacccatggtacagaaggaacagagcagacccccctca
ggggcttcacttatacgttgttgtaagtttctgaggaactcggcagggccaatgagtgca
ggccacgtgcatcccccttccatggctggcatggtaggacatccctcagtcatcagcacc
tccagacccctaccatcccccatgtccaccctgggctcgccgatgaacggcctggcatcg
ccttatcccgtcatcacgtcatctctgggatcaccctccgtacccctccagtctactccc
aacatgaactttggagcaatcagcagtccacagatgaactcaatgaacagtgttagcagt
tcggaggacatcaagcctccgccgggcctgcagtctctgggaaacatcaactaccaatgt
acgagcccgggggggatgtcaaagcacatctgtgctatctgcggggatcgctcttcagga
aagcactatggtgtgtacagctgcgaaggctgcaaaggcttcttcaagcgcactgtccgt
aaagatctcacctacacgtgtcgagacagcaaagagtgcctgatagacaagcgccagcgg
aaccgctgccagtactgtcgctatcagaagtgcctggccatgggcatgaagagggaaggt
gtgggtgtgtgtgcagccgtgcaggaagagaggcagcgagggaaggagcgtggcgagaac
gaggtggaatccaccagcagtttcaacgacgacatgccggtggaaaagatcctggatgct
gagctggctgtggagcccaaaacggagacgtacagcgatggaagccccggaaactcgacc
aacgaccccgtcactaatatctgccaggcagcagacaagcagctcttcaccttggtggag
tgggccaaaaggatcccacacttctctgagctccctctggacgaccaggtcatcctgctt
cgagcaggctggaacgagctgctcattgcctctttctcgcatcgctcagtcacggttaaa
gacggcatcctgttggctacaggtctacacgtgcacagaagtagcgcccacagtgcagga
gtgggatccatcttcgacagagtcctcacagagttggtatccaaaatgaaagacatgcag
atggataagacagagctgggctgcctgcgagccatcgtcctattcaacccagatgctaaa
ggtttgtcaaacccatcagaggtggaggcgctaagggaaaaagtctacgcatcattggag
tcgtatacaaaacagaagtaccccgaccagcctggcaggttcgccaaactgctgctgcgg
ctgccagctctgcgctccatcggcctcaagtgtttggagcatctgttcttctttaaacta
atcggggacacgcccattgacactttcctgatggagatgctggaggctccgcatcagatc
acatga

KEGG   Poecilia reticulata (guppy): 103472931
Entry
103472931         CDS       T05149                                 

Definition
(RefSeq) retinoic acid receptor RXR-beta-A isoform X4
  KO
K08525  retinoid X receptor beta
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103472931
   03320 PPAR signaling pathway
    103472931
Transcription factors [BR:pret03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103472931
Nuclear receptors [BR:pret03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103472931
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 103472931
NCBI-ProteinID: XP_008421032
LinkDB
Position
LG11
AA seq 450 aa
MGDSRDSRSPDSSSVSSPPSGQRSPPLVPSAASMTSLPPITTTGVNSPISSIGSPFSVIS
SSLDSPCLPGTPSVGYGPISSPQINSTVTMSGLHAVSSSDDVKPPLGLKQLSSHSPGPML
SQKRLCSICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCIVDKRQRNRCQY
CRYQKCLAMGMKREAVQEERQRNKEREGEVESTSAVNEEMPVEKILEAEMAVEQKTELHA
DGSSGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIAS
FSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRA
IILFNPDAKGLSNSSEVELLRERVYASLESYCKQKYPDQQGRFAKLLLRLPALRSIGLKC
LEHLFFFKLIGDTPIDTFLMEMLEAPHQLT
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgggagacagcagagattctcgcagtccagacagctcgtctgtgtcttcccctccctcg
ggccagcgctccccrccgctggttccctctgcagcttccatgacttcactgccacccatc
accaccacaggggtcaacagccccatcagtagcattggttcacccttttctgttattagc
tcatcactggactcaccctgccttcctggcacrccgtcagtgggatatggcccaattagc
agcccccagatcaactcaacagtgaccatgtcagggctccatgcagtgagcagctccgat
gatgtgaaacctcctcttggcttgaagcagctgtcttcccacagcccagggccgatgctt
tcccagaaacgcctttgttccatctgtggagacagatcctctggtaagcactatggcgtc
tacagctgcgagggctgtaagggcttcttcaagagaacagtgcgaaaagacctaacctac
acctgtcgggacaataaagactgcatagttgataaaagacagaggaaccgctgccagtac
tgccgctaccagaaatgcctggcaatgggaatgaagagagaagctgtccaggaggagcgg
cagagaaacaaggagcgcgaaggcgaggtggagtcgaccagcgcagtgaacgaggagatg
ccggtggagaagattttggaagctgagatggccgtagagcagaagacrgagcttcatgca
gatggaagttcaggcggcagctctcccaaygatccggtcaccaacatctgtcaggcagca
gacaagcagctcttcactctggtggagtgggccaagaggatccctcacttctctgagctt
cctctggatgaccaggtcatcctgctgcgcgcaggctggaacgagctgctgattgcgtcc
ttctcccatcgctccatctcggtgaaggacggcattttgctggccactggcctccacgtc
cacaggaacagcgcccacagcgcaggggtcggagccatattcgacagggttctgacagag
cttgtaagcaaaatgagagatatgcagatggacaagacagagctgggctgccttcgagct
atcattctctttaacccagatgccaagggtttgtccaactccagtgaggtggagcttctg
cgagagagagtttatgcgtctcttgaatcgtactgcaaacagaaataccctgaccagcag
ggcaggtttgccaagctcctcctccgactcccagcactgcgctccatcggtctgaagtgc
ctggagcatctattcttctttaaactgatcggtgacacgcccattgacacctttctgatg
gagatgctcgaggcgcctcaccagctgacttaa

KEGG   Poecilia reticulata (guppy): 103474009
Entry
103474009         CDS       T05149                                 

Gene name
rxra
Definition
(RefSeq) retinoic acid receptor RXR-alpha
  KO
K08524  retinoid X receptor alpha
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103474009 (rxra)
   03320 PPAR signaling pathway
    103474009 (rxra)
Transcription factors [BR:pret03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103474009 (rxra)
Nuclear receptors [BR:pret03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103474009 (rxra)
SSDB
Motif
Pfam: Nuc_recep-AF1 zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 103474009
NCBI-ProteinID: XP_017163162
LinkDB
Position
LG12
AA seq 447 aa
METKPFLSLGFLKPQCSLAPPMQRGRSSEVCSCFSGVCPLHQRRLSSDSSGQVTSSPLGS
PTSHRGMHPSLLSPTSMGPSGSLHSPISTLSSPMNGLTSPFSVISSPMGPHSMNSPGMGY
GPSISPQVRPQLNSPMNSVSSTEDIKPPLGLNGVMKVPAQPSGTALSLTKHICAICGDRS
SGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCVIDKRQRNRCQYCRYQKCLAMGMKR
EAVQEERQRAKDKNENEVESTSCVNEDMPVEKILEAEEAVEPKTETYIETNLGMPSNSPN
DPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKD
GILLATGLHVHRNSAHSAGVGAIFDRSLCRVLTELVSKMRDMQMDKTELGCLRAIVLFNP
GNNHEQVFTFSWSFEKGLQSEGYKGGA
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggaaaccaaaccgttcctgtcattggggtttttgaagccccagtgctcattggctccc
cccatgcaacgaggtcgttcgtctgaggtgtgttcatgtttcagcggtgtttgtcccctc
catcagcgtcgcctatcctcagattcttcaggacaggtgacctcctcacctttaggctct
cctacttcccatcgtggaatgcatccctctttgctgagccccacctccatggggccctct
ggctctctccattctcccatcagcaccctgagttcaccgatgaacggcctcacctcaccc
ttctcagtcattagctcacccatggggccgcactccatgaactcacctggcatgggctac
ggccccagcatcagcccacaggtgaggcctcagttgaactctccgatgaactcggtcagc
agcacggaggacattaagcccccgctgggcctcaatggcgtgatgaaggtgcccgctcag
ccctcaggcacggctctgtcgctcaccaaacacatctgcgccatctgtggcgaccgctcc
tcaggaaaacactatggtgtctacagctgtgaaggctgcaaaggcttcttcaaacgaacc
gttcgcaaggacttgacctacacctgccgcgacaacaaggactgcgtcatcgataagcgc
cagaggaaccgctgtcagtactgccgctaccagaagtgcttggccatgggcatgaagaga
gaagccgtccaggaggagcgccagcgagccaaggacaagaacgagaacgaggtggagtcc
accagctgcgtgaacgaggacatgcccgtggagaagatcctggaggccgaggaggcggtg
gagcccaaaaccgagacctacatcgagaccaacctggggatgccgtccaactcgcccaac
gacccagtgacaaatatctgtcaggcggcagacaagcagctttttactctggtggagtgg
gccaagaggattccccacttctcggagctgccgctggacgaccaggtcatcctgctacga
gcaggttggaatgaactcctcattgcatcattttcgcaccgttccatcgcagtaaaggay
gggattctgttggcracgggcctgcacgtgcatcgcaacagcgcccatagtgccggagtg
ggagccatctttgacaggtcgctctgtagggtgctcacagagctggtgtcaaagatgaga
gacatgcagatggataagactgagctgggttgcctccgagccatcgtccttttcaaccca
ggtaacaatcatgagcargttttcactttcagctggagctttgaaaaaggtctgcaaagt
gagggttataaaggaggagcataa

DBGET integrated database retrieval system