KEGG   Poecilia reticulata (guppy): 103463840
Entry
103463840         CDS       T05149                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04020  Calcium signaling pathway
pret04144  Endocytosis
pret04510  Focal adhesion
pret04540  Gap junction
pret04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103463840 (pdgfra)
   04020 Calcium signaling pathway
    103463840 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103463840 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103463840 (pdgfra)
   04540 Gap junction
    103463840 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103463840 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103463840 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pret04090]
    103463840 (pdgfra)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103463840 (pdgfra)
Protein kinases [BR:pret01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103463840 (pdgfra)
CD molecules [BR:pret04090]
 Proteins
  103463840 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 C2-set_2 V-set Herpes_gE
Other DBs
NCBI-GeneID: 103463840
NCBI-ProteinID: XP_008405697
UniProt: A0A3P9Q3R3
LinkDB
Position
LG4
AA seq 1457 aa
MDGLRMYLVCGVAIVLMISVTPGLSAPTIWPERDELVVEPHSIINISCTGQSEVVWEEPL
PDDAVVSSNGFASTLLIYNATVELTNYYGCRHKNEEGNHNDLVEIYVLVKDPRVAFVPER
ADDVLVPYEDDLIIPCRVTAQTHDVELIRVNDGEKLHRYYDYRVGFMGDLSPGQYRCEAT
FNGQTFQSDIYTVMSLESTEVSDFEVEVKASAGTVRVGEPFNVSCIGPFGPAFHQQWIHL
KTQAVNAIRTTESFPDWVIYTLSIPRAAAQDGGSYECSVRHKASGKTRVSSVAVSVFEGN
SFVILDHRGILQTESVGILAETQYTIYINAYPAPKVSWMKDGQALSENYYISSKTSHMEG
NRYQSIVTFRQPMEKDSGNYTITAISGSRSAHFSFILQVTGSTRLNIRPSSPPILLPDED
EIVVPLHAPFTLTCRGGAKLMWETPYDMLEQSQEDNSGLFVTTIAVDEATPVHTGYYVCL
YNDHIAEETKTSSIYIYVLDPDSVFVPNYINHVPVDQNEIEIPCRVSDPSATVTLVNVDT
NQTVPSDYDSKKGALGIFPTGTYVCKAIINGVEHTSEQYIVHESIDVLHVELSAKRTALL
VGDTITVNCLAQGPYLLEDNWKYPGKPANRGTKTVRENKNEGRILYTLTIPQASTKDSGI
YSCSITTVESRDTQTKEIAIQVFAGEFLSIKPEFRDHESAELDDVREFIATISSFPDAHV
TWLKDGVLLSDLTAEISTSLKQTSETSYRSILTLIRVREEDSGNYTLRVENGNQSHEVSL
NLVVKVPAVIVDLMDIHHGSATGQSAVCITRGQPTPVVEWFICMNIKQCANDSSFWTPLP
TNSTEITMESHFDEESNLESQVMFGHLKSTLAVRCLAKNEIGAVSREIKLVSNGPHPELT
VAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRW
EFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELK
IMTHLGPHLNIVNLLGACTKSGPIYIITEYCFHGDLVNYLHKNRESFLSLSPEKNKKELD
IFGINTADENSRSYVILSFECKGDYMDMKQADNTQYVPMLEMSTTSKYSDVQGSNYDHPS
SQKDSGESDNLLSDDMSKGLTTTDLLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGK
IVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTSLSDVWSYGILLWEIFT
LGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPQDVYEMMMKCWNTEPEKRPSFMGLSENV
ASLLPSSYKRHYEKVNHDFLKSDHPAVTRVCIETDADYVDIPYKNQGKLKDRESGFDEQR
LSSDSGYIIPLPDLDPISDDDYGKRNRHSSQTSEESAIETGSSSSTYAKREGETLEDITL
LDEMCLDCSDLVEDSFL
NT seq 4374 nt   +upstreamnt  +downstreamnt
atggatggcttgaggatgtacctggtctgtggtgttgccattgtgttgatgatttcagtt
acacctggactgtccgccccgaccatatggccagaaagagacgagctggtggtggagccc
cactccatcatcaacatcagctgtacgggccaatcagaagtagtctgggaagaacctctg
ccggacgacgccgtcgtttcttcaaacggtttcgcctcaactctcctcatttacaacgcg
acggttgagctcaccaactattacgggtgcaggcataaaaacgaggagggcaaccacaac
gatctggtggaaatctatgtccttgtcaaagatcctcgggtcgcgtttgtcccagagaga
gcagatgacgtgctcgttccctatgaggatgatttaatcatcccatgccgagtgacggca
cagacccacgatgtggaactgatccgtgtgaatgatggagagaagctccacaggtactac
gactacagagtgggcttcatgggtgacctctctcctggccagtaccggtgtgaggccaca
tttaatggccagactttccaaagtgacatctacaccgtaatgagtttggaatctaccgag
gtgagcgactttgaggtggaagtcaaagccagcgcggggacggtgcgagtcggggagccc
tttaacgtctcctgtatcggaccctttggcccagccttccaccagcagtggatccatctg
aaaacacaggctgttaatgcgattcggacaacagaaagttttcctgactgggttatctac
actctgagcatcccgcgagccgccgctcaggacggcggcagctacgaatgctcggtcagg
cacaaggccagtggaaaaacccgggtgagcagcgtggctgtgtctgtgtttgagggaaac
tcctttgtcatcctggaccacagagggattctacagacggagtctgttggcattctggca
gagactcagtacaccatctacattaatgcatacccggccccaaaagtgtcatggatgaaa
gacggccaagcgctgtcggagaactactacatttcttccaaaactagccacatggaagga
aatcggtatcagagcatcgttacgttccggcagcctatggagaaagacagcgggaattac
acaatcacagccataagtggctctcgcagcgctcacttctcatttatcctccaagtgaca
ggttccactagacttaacatcagaccgtcctccccccctattctgctaccggacgaggat
gagattgtcgtccctctccacgcgcctttcacgctgacgtgtcgtggaggtgcgaagctg
atgtgggaaactccgtacgacatgctggagcaatcgcaggaggacaacagtggccttttc
gtcaccaccatcgctgttgacgaagcgacacctgtgcacaccggttactacgtttgcctc
tacaatgaccacattgcagaggaaaccaagaccagcagtatttacatctatgtattggat
cctgactctgtgttcgtgccaaattacattaaccatgtgccggttgaccaaaatgagatc
gagattccctgcagggtgtctgatcccagtgctactgtgacactggtgaatgttgacacc
aaccaaaccgtacctagtgattatgacagtaaaaagggtgctttgggaatatttcctact
ggaacttatgtctgcaaggccatcatcaacggagttgaacataccagtgagcaatacatt
gtccacgaatccatagatgtcttgcacgttgagctgtctgccaaaagaactgctttgctg
gttggagacacaataactgtcaactgtctggctcaaggaccttatttactggaagacaac
tggaaataccctggcaaaccggctaatcggggtaccaaaactgtacgggaaaataagaac
gaaggccggatcctgtacaccttgacaatcccacaagcctcaaccaaagacagcggcatc
tactcttgttccattaccactgtagagtctagagacacgcaaacaaaggaaatagctatt
caagtgtttgccggtgagtttttgtccatcaagccggagttccgggaccacgaatctgct
gagctagatgacgtccgggagttcattgccacaatttcttcctttcctgatgcccatgtt
acttggctcaaggacggtgtcttgctcagtgacctgactgctgagatctccaccagtttg
aagcagaccagtgagacaagctacagaagtattctcaccctgatccgggtaagggaggag
gacagtgggaactacacccttcgggtggagaatggaaaccagagccatgaagtcagctta
aacctggtggttaaagtgcctgcagtcattgtggacctcatggacatccaccatggttcc
gccacaggacagtctgcggtgtgcattaccagggggcagcctactcctgttgtggaatgg
ttcatatgcatgaacatcaaacaatgcgccaatgactcgtctttttggacgcctctaccc
accaactccacagagatcaccatggagtcccactttgatgaggagagcaacctggagagc
caggtcatgtttggccatctgaaaagcactctggctgtgcgatgccttgccaagaatgaa
ataggagctgtcagcagggagatcaaattggtgtccaatggccctcaccctgagctgacg
gtagctgctgctgtgctggtgctcctggtcattgtcatcatctcactcattgtcttggtt
gttatctggaagcagaaaccacggtacgagatccgctggagggtcatagagtctgtgagt
ccagacggtcacgagtacatctatgtggatcccatgcagcttccctacgactccagatgg
gagtttccccgagatagacttgtgcttggccggatcctgggctctggagccttcggcaag
gtggttgagggcactgcctacggactcagccgctctcagcctgttatgaaggtggcagtg
aaaatgctgaaacccacggctcgctccagtgagaagcaggctctgatgtctgagctgaag
atcatgactcacctcggacctcatctcaacatcgtaaacctcctgggagcgtgcaccaag
tcaggccctatctacattatcaccgagtactgcttccacggcgacctggtcaactatctg
cacaagaacagggagagcttcctcagcctgagtccggagaaaaacaagaaggagctggat
atctttgggatcaacactgcggacgagaacagcaggagttacgtgatcctgtccttcgag
tgtaaaggagactacatggacatgaagcaggcggacaacacccagtatgtgcccatgctg
gagatgagcacaacctccaagtactctgacgttcagggatctaactacgaccacccttct
tcacagaaagactcaggcgaatccgacaacctgctgtcagacgacatgagcaaaggcctc
acgaccaccgacctgctcagcttcacctaccaggtggctaaagggatggagtttctcgcg
tccaaaaactgcgtgcatcgggaccttgcagccaggaacgtccttctctctcaaggcaag
attgttaagatctgtgactttgggctggccagagacatcatgcatgacaacaactacgtc
tccaaaggaagcacctttttgccggtgaagtggatggccccggagagtattttcgacaac
ctgtacaccagtcttagcgacgtttggtcatatggcatcctcctctgggaaatattcacc
ctgggtggcactccgtacccggggatggtggtggactccagcttctacaacaagatcaag
agcggatacaggatgtcaaaacctgagcacgcgccgcaagacgtgtacgagatgatgatg
aagtgctggaacacagagccggaaaagaggccttccttcatgggtctgagtgaaaatgtg
gcgtctctgctgccctccagctacaagaggcactatgagaaggtgaaccacgattttctg
aagagcgaccatcccgccgttacccgagtctgcatcgagacggacgcggactacgtcgac
attccctacaagaaccagggcaagctaaaggacagggaaagtggctttgacgagcagcgg
ctgagctccgacagcggctacatcatcccactccctgacctggaccctatatctgatgat
gactatggaaaaaggaacagacacagctctcaaacgtctgaggagagcgccattgagact
ggctcaagtagctccacctacgctaagcgcgagggcgagaccctggaggacatcacgctg
ttggacgagatgtgtctggactgtagcgacctggtcgaggacagctttctgtga

DBGET integrated database retrieval system