KEGG   Poecilia reticulata (guppy): 103464361Help
Entry
103464361         CDS       T05149                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103464361
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103464361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 103464361
NCBI-ProteinID: XP_017160114
LinkDB All DBs
Position
LG5
AA seq 791 aa AA seqDB search
MFYSNDFSSSGGFSDTNGFQWSNGSSSINGSSSINGSSTNGINGSSSINGSNTNGSSSIN
GSSTINGSSFLKNRFKNHRHSAFQEVDLHSATNNKAHHSSSISEKQLIVRRGQPFNITLK
MTQPFNPDSDQLTMKVVTGKHPSQEQGTMSSFGFPDKVKRSSRAKAVWRAELQENSLPET
GTLALTITPPADAPVGEYKLSAGLKAEEKELAQLFVLFNPWCSDDWVFLPNEAERQEYVM
NQHGIIYTGSDQHINGLSWDFGQFEEDMVKICLKLLDLSRKHKRDPADDVSARCNPIYVS
RVMTNMVNKEQMNDGVLRGNWSDDFKHGFPPTHWSGSYAILKLWFASFCKAVNYGQCWVF
AGVLCSVMRLLGIPCRVVTNFESAHDSDANLTIDTYYGEFGVKPKKSNDSVWNFHVWVEG
WMRRPDLGEDGRYDGWQVLDGTPQEKSEGVFCCGPAPVAAILNGNVDLKYDVPFVFAEVN
ADRVTWLIKRDGSKVQMKSDTRSVGQYISTKAVGSNRRMDITSAYKYTEGSARERDVFRY
ALTRLDADSRIAVCPIAVEPEAPVINDTTDTENGHATPQLIVKFEEESAPVKGQDVKKNL
ALRSEGSAARMLSVNINVQAMTYTGQPKGNIQNEVVQKQLLPGKDLTIPIQIPYVTYSKY
MVDCQTMNISAMITDLQNDETYLAANRVVLKDPPITITVSDEARVNQKLSVLVMFMNPIS
ETLTDCSLTLSGTGLIDWEQTVKLEDLMPNKKMSVELSVVPYRSGERTLLADFDCAAFRD
IKASCVVNVRP
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgttctactccaacgacttcagcagctcaggcggcttcagcgacaccaacggcttccag
tggtccaatgggtccagctccattaatgggtccagctccataaatgggtccagcaccaat
ggcattaatgggtccagctccattaatgggtccaacaccaatgggtccagctccattaat
gggtccagcaccattaatgggtccagctttctcaaaaaccggttcaaaaatcaccgacat
tcagcttttcaggaagtggacctgcacagtgcgaccaacaacaaggctcaccacagcagc
tccatctcagagaagcagctgattgtgaggagaggccagccgttcaacataaccctgaaa
atgactcaacctttcaaccccgactctgatcagctcaccatgaaagttgtgactggaaaa
catccatctcaggagcaagggacgatgtcatcgtttggttttccagacaaagtgaaacgt
tcatcacgtgctaaagcagtctggagagcagagcttcaagaaaacagccttcctgaaaca
ggaacgttggctctaacgataacgccgcccgctgacgctccggtcggggagtacaaactt
tctgcaggacttaaagccgaagaaaaggagttggcacaactctttgtgctcttcaaccct
tggtgttctgatgactgggtgtttctgcctaacgaggcggagagacaagaatacgttatg
aaccaacatggaataatctacacaggttctgatcaacacattaatggactttcctgggac
tttggacagtttgaagaggacatggtgaagatatgcctgaagttactcgacctgagcagg
aaacacaagcgggatccggctgacgacgtttctgctcgctgtaaccccatctacgtcagc
cgcgtcatgaccaacatggttaacaaagaacaaatgaacgatggcgtcctgaggggaaac
tggtcagacgattttaaacatggcttcccaccgacccactggagcggcagctacgccatc
ctgaagctgtggttcgcctccttctgcaaggctgtcaactacgggcagtgctgggtgttc
gccggcgtcctgtgttcagtgatgcgcctgttgggaatcccctgccgtgttgtcactaac
ttcgagtccgctcacgactccgacgctaacttgaccatcgacacctactatggagaattt
ggtgtcaaaccgaaaaagtccaatgacagcgtctggaacttccacgtctgggtagagggg
tggatgagacgaccggatctgggagaggacggccgatacgacggctggcaggttctggac
ggaacgccgcaggaaaagagtgaaggtgtgttctgctgtggtccagctccagtagcggcc
atcttgaacgggaacgttgacctgaaatatgacgtaccttttgtcttcgctgaggtcaat
gctgaccgtgttacctggctgatcaaaagggatggatccaaggtgcagatgaagtctgac
accaggagtgttggacagtacatctccaccaaggcggttggttccaaccgccggatggac
atcacgagtgcctataaatacacagaaggatcggcgcgggaaagggacgttttcagatac
gccctgaccagactggacgctgattcaagaattgcagtgtgtccaatagctgtcgaacct
gaagcaccggtcataaacgacaccactgacacagagaatggccacgcaactccgcagctg
attgttaaatttgaagaggagtccgcaccagtgaagggtcaggacgtgaagaagaacctg
gcgctgagaagtgaaggcagcgctgccaggatgctgtctgtcaacatcaacgtccaggcc
atgacgtacaccggccaaccaaaaggaaacatccagaatgaggtcgtccagaaacaactg
cttcctggaaaagatctgaccatccccatccagatcccgtacgtcacctacagtaaatac
atggtagactgccagaccatgaacatttcagccatgatcactgacctccagaacgatgag
acctacctggcagcgaaccgcgttgtgctgaaagaccctccaatcaccatcactgtgtct
gatgaagccagagtgaatcagaaattgagtgtcttggtgatgttcatgaatccgatcagc
gagacgctgacagattgctctctgactctctctggaactggacttattgattgggagcag
acagtcaaacttgaagatctgatgccaaataagaaaatgagtgtggaattgagcgtcgtt
ccctacaggagcggggagaggactctactggccgactttgactgcgccgctttcagagac
atcaaggccagctgcgtcgttaatgtcagaccttaa

DBGET integrated database retrieval system