KEGG   Poecilia reticulata (guppy): 103464454Help
Entry
103464454         CDS       T05149                                 

Gene name
park7
Definition
(RefSeq) protein deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
pret  Poecilia reticulata (guppy)
Brite
Enzymes [BR:pret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     103464454 (park7)
Peptidases [BR:pret01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   103464454 (park7)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103464454 (park7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 103464454
NCBI-ProteinID: XP_008406797
LinkDB All DBs
Position
LG5
AA seq 189 aa AA seqDB search
MAGKRALVILSKGAEEMETVIPVDIMRRAGIAVTVAGLTGKDPVQCSRSVVICPDASLEE
ASKQGPYDVVLLPGGMPGAKNLAESPAVKEVLKDQDGRKGLIAAICAGPTALLAHGIGYG
STVTTHPGMKEKMMVGDHYKYSEARVQKDGHYITSRGPGTSFEFALXIVEELMGAEVAAQ
VKAPLMMKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaagagagcgttagtgatcctgtctaaaggtgcagaagagatggaaactgtg
attcctgtggacatcatgcgcagagccgggattgcagtgacggttgcgggtctgacagga
aaagatccagtccagtgcagcagaagtgttgtaatctgtcccgatgccagtctggaggaa
gccagcaaacagggcccttatgatgtggtgcttctgccagggggaatgccaggagccaag
aatctggcagagtctcctgctgtgaaggaggtgttaaaggaccaagatggcagaaaaggc
ctgattgcagccatctgtgcaggtccgaccgctcttctggctcatggcatcggttacggc
agcacagtcaccacacatcctggcatgaaggagaagatgatggttggagatcactataaa
tattcagaagctcgagtgcagaaagatgggcattacatcaccagccgtgggccaggaacc
agttttgagtttgccctgaygatcgtagaggaacttatgggggctgaggttgcagctcaa
gtcaaggcgccactcatgatgaaagactga

DBGET integrated database retrieval system