KEGG   Poecilia reticulata (guppy): 103464471
Entry
103464471         CDS       T05149                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1B-like
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04060  Cytokine-cytokine receptor interaction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103464471
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103464471
Cytokine receptors [BR:pret04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103464471
CD molecules [BR:pret04090]
 Proteins
  103464471
SSDB
Motif
Pfam: TNFR_c6 Syndecan Adeno_E3_CR2
Other DBs
NCBI-GeneID: 103464471
NCBI-ProteinID: XP_008406815
UniProt: A0A3P9NF40
LinkDB
Position
LG5
AA seq 441 aa
MKDILVLLLLLTLRTIKVCSLPYLPDSYGNCLDLTKEYLHDGINLCCKKCPPGQRLKQEC
SGSSDTVCEPCGPEQYIETWNYTPNCLSCTKCKDKKGLENNQTCTPTRNAKCVCKRGMFC
EFGFDNPYCTDCRSYKVCRPGFRVSEPGTLNSDVKCEKCPTDPCPPRTTVQTVTTTVTVN
ATTPRGPQQTTQQPDRPLLTMRPKGSKAEQPISEMVAVIAGASGFLLFLIIVFLLLILCK
RKKARDSGHLSPKVDANGNCEAAEQNGHNNFGDSQMISFKRTSPEQMCLLEKGEVASDQS
VSSSDTETSTRADGFSSHESLRPLQPTLGLDNPASLLSEPLTLQSVTDPVAPQRSISTQS
SSQPTSPQIISPVTNSPHVNVNITLHIGNGSCGTPSFQPTDFNQAEHQLPFGQEEESVSS
PQQEAGKLSFMSVEESPSYST
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaaggacatactggttctgctacttctgctgacactccgaactatcaaggtttgctck
ctcccatatctgcctgactcctatggaaattgtctcgacctgacaaaagaatayttgcat
gatggtattaacttgtgctgcaagaaatgccccccggggcaacgactgaagcaggagtgc
tctggaagctctgacacagtgtgtgaaccatgtggaccagagcagtacatcgagacctgg
aactacaccccaaactgcttgtcctgcaccaagtgcaaagacaaaaaaggtcttgagaat
aaccagacctgcaccccaaccagaaacgccaagtgtgtttgcaaacgtgggatgttctgt
gagttcgggtttgataatccgtactgcacagactgcaggtcgtataaagtttgcagacct
ggatttagagtttctgagccaggcacgctgaactctgatgtgaagtgtgagaaatgcccc
accgatccctgtccgcctcgcaccacagtacaaacggtgacgactacagttacagtaaac
gccacgacgccacgaggcccacagcagacgacgcagcagcctgacaggcctctcctaacc
atgagacccaaaggctctaaagcagaacaacccatcagcgaaatggttgcagtcattgct
ggtgcctctggattccttttgtttcttatcatcgtcttcctcctgctgatactttgcaaa
cgaaagaaagctagagattctggacacttatcacctaaagtagatgcaaatggaaactgt
gaggcagcagaacagaacggccacaacaacttcggagattctcagatgatttcattcaaa
cgtacatcaccggagcaaatgtgtctgctggagaaaggggaagtcgccagtgaccaaagt
gtgagcagcagcgataccgaaacttcaaccagggcggatggtttcagcagccatgagtcc
ctcaggcctctacaaccaactttaggtctcgacaatccagcgtctctcctgtcggagccc
ctgaccttacagtccgtcacggaccccgtcgctcctcagcgcagcatcagcacacagagc
tcctctcagcccaccagcccacagatcatcagccccgtaacgaacagtccccacgtcaat
gtcaacatcactctgcatataggaaacggttcctgtgggacgccatcttttcagccgaca
gactttaaccaagcggagcatcaacttccctttggacaggaagaggagtccgtcagctct
cctcagcaagaggcaggcaaactgtcgtttatgtcagtcgaagagagccccagctatagc
acatga

DBGET integrated database retrieval system