KEGG   Poecilia reticulata (guppy): 103464482Help
Entry
103464482         CDS       T05149                                 

Gene name
ppcs
Definition
(RefSeq) phosphopantothenate--cysteine ligase isoform X1
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00770  Pantothenate and CoA biosynthesis
pret01100  Metabolic pathways
Module
pret_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    103464482 (ppcs)
Enzymes [BR:pret01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     103464482 (ppcs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP
Motif
Other DBs
NCBI-GeneID: 103464482
NCBI-ProteinID: XP_008406840
LinkDB All DBs
Position
LG5
AA seq 330 aa AA seqDB search
MPLLSYQIMAEPRISSIDGKLTEEFAVPSHVEEVKEKMAAFAARHAEAGRRVVLITSGGT
KVPLESRTVRFLDNFSSGRRGASSAEYFIDSGYAVIFLHRHRSLYPYTRLFSTINMLDAL
QLRAGDGEGAGKVVVDQQVLPNIARVLKRYNEVKDGGLLLPIEFNTLSEYLHLLKAAAQA
LSSIGSKAMFYLAAAVSDFYIPASEMPEHKIQSSNGPLQLSMKMVPKILSPLVKDWAPQA
FVTSFKLETDPTILLDRARRALDTYRHQAVVANVLDSRRGYVVVVTPESRDELVVTEGDV
EKGVEIEERIVSNLTTAHNKFITQQAAGRK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttctctcttatcagataatggccgaacccagaatatcgtccattgatggaaag
ctgactgaagaatttgccgttccctcccacgtcgaggaggtcaaggagaagatggccgct
ttcgccgcccgtcacgccgaagcgggccgcagagtggtcctcatcacgtcaggcggcacc
aaagtccccctggagtcgcgcaccgtccgcttcctggataacttcagcagcggcaggcga
ggagcctcctcggcggaatacttcatcgactcgggctacgccgtcattttcctgcacagg
caccgctctctctacccctacacacgcctgttctccaccatcaacatgctggacgccctg
cagctcagggcgggagacggtgaaggagcggggaaggtggtggtcgaccagcaggtgctt
ccaaacatcgccagagtgctgaagaggtacaacgaagtgaaagacggaggacttcttcta
cccatcgagttcaacactctttcggagtatctgcatttactgaaagcagcggcacaggcg
ctcagctctatagggtcaaaggccatgttctacctggctgcagccgtctccgacttctac
atcccggcgtcagagatgcctgaacacaaaatccagtcttccaacggacctcttcagctc
agcatgaagatggttcctaagatcctgtcgccgctcgttaaggactgggcgcctcaggcg
ttcgtcacgtccttcaagctggagacggacccaaccatcctgctggacagggcccggcgc
gctctggacacctacaggcaccaggcggtggtggccaacgtgctggactcgcggcggggt
tacgtggtggtcgtgaccccggagtcccgggatgagctggtcgtcaccgagggcgacgtg
gagaagggcgtggagatcgaggagcggatagtgagcaacctgacgacggcgcacaacaag
tttataactcagcaagccgctggacggaaatga

DBGET integrated database retrieval system