KEGG   Poecilia reticulata (guppy): 103464507
Entry
103464507         CDS       T05149                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
pret  Poecilia reticulata (guppy)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 DUF5111
Other DBs
NCBI-GeneID: 103464507
NCBI-ProteinID: XP_008406875
UniProt: A0A3P9NBA8
LinkDB
Position
LG5
AA seq 365 aa
MSWGEFIELRDLNSSREQIELAGPRSPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
SSQDPQFVEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
RLDCSWERGSTADLTAVVEHTIETDTNVDEQIQCEKQELTTAEILQKVKEYNSQINSNLF
INMNKDGSYTGFVKVQFKLARPVSVPASKKGGADAGGKRASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLNAGPN
EKLLSFVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIVQRYTLARTKMLEALS
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggggagttcatcgagctgcgggacctgaactccagcagagagcagatagaa
ctggcaggcccgcgttcgccgtgctcacccccacgcctggagcgaaccaacgccttgagg
atcagcccggggaaggtgccggacctgctgagccgcgtgggcatcatccgggtcctgagc
agctctcaggatccccagtttgtggaggagaaaggagagggacacaactttcagccctgc
agccacgctcagccaacatggtgcgacctgtgcggcgacttcatctggggcctttacaag
cagagcctgcggtgtgtcaattgcagattcacgtgccactatcgctgccgtgcgctgatt
cggctggactgcagctgggagcgaggctctacggcggacctcaccgctgtcgtggagcac
acaatcgagaccgacaccaatgtggatgaacaaatccaatgtgagaaacaggagctaaca
actgctgaaattctgcagaaagtgaaggaatacaactcccagatcaatagcaatctgttc
ataaacatgaacaaggatgggtcctacactggttttgtgaaggttcaattcaagctagca
cgccccgtgtcggtcccagcgtcaaaaaaaggaggtgctgatgctggagggaagcgagcc
agcggagtgaagcgtcgcacctccttctacctgccaaaggacgcctccaagcatttgcac
ataagctcccgtacttctgctcgcgaggtcatcgaggctctgctgaaaaagtttactgtg
gtagacaatcctggcaagtttgcactgtttgagcgcagcgagcgccatgaccaagtttat
gttcgcaagctctctgacgacgagcgtcctctccgtttacgcctgaatgctggacccaat
gagaagctcctcagttttgttctcaaagaaaatgaaactggtgaagtgaattggcatgct
ttctccatgcccgagctgaagaacttcctgctcatcctgcaacgtgaggaagaggagcac
gtcaagcagatcgtacagcgatacactttggctcgcaccaagatgctggaggcgctgtcc
ggctcgacccccggctga

DBGET integrated database retrieval system