KEGG   Poecilia reticulata (guppy): 103464582
Entry
103464582         CDS       T05149                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103464582 (tgfa)
   04012 ErbB signaling pathway
    103464582 (tgfa)
SSDB
Motif
Pfam: EGF Laminin_EGF hEGF Pannexin_like
Other DBs
NCBI-GeneID: 103464582
NCBI-ProteinID: XP_008407004
LinkDB
Position
LG5
AA seq 248 aa
MTRILWDAIFLISGSFFTFGAGPSSSAVIEANVSIETLATSAPDASSSNSLTTSGKGTST
ANFLTSRSSLFTSEQTNSTVADAAVSLNTSAAAAASRSPTSSSSTTTSSTTSTTRRPAAT
TSKRPVKKFVAAAVRSHFDDCPDSHRHFCFHGTCRFLILEETPACVCHPGFVGMRCEHAD
LLAVVATNHRKQAVATVLVLCVIGCVLIMVLCSFLHCWWREDCRRRSRAHLYVAEKHGAT
CYPPESVV
NT seq 747 nt   +upstreamnt  +downstreamnt
atgactcggattttgtgggatgctatttttctcataagcggttccttctttacatttgga
gcaggtccgagcagttcagctgtgattgaagcgaatgtttccatcgagacactcgccacc
tctgctccagatgcatccagtagcaactctttgaccaccagtggcaaaggaacaagcact
gctaactttcttacaagtagaagttctctttttacatcagagcaaacaaattcaacagtc
gcagatgctgcagttagtcttaatacctctgctgctgctgctgcttctcgcagcccaaca
agcagctcctcgacaaccaccagcagcacaacctcgacaaccagaagacctgccgcaacg
accagcaaacgtccagttaaaaagtttgtggctgcggctgttcggtctcacttcgatgac
tgtcctgactctcatcggcatttctgctttcatggcacctgccgcttcctgatcctggag
gagacgcctgcatgtgtgtgtcacccaggctttgtcgggatgaggtgtgagcacgcagac
ctgctagctgtagtagcgaccaaccacaggaagcaggctgtggccacagtgctcgtgctg
tgcgtgattggatgcgtcctcatcatggtgttgtgttcctttttgcactgctggtggagg
gaggactgtcggaggcggagccgagcgcatctctacgtggcagaaaagcacggagcgaca
tgctatccaccagagagtgtggtttga

DBGET integrated database retrieval system