KEGG   Poecilia reticulata (guppy): 103464655
Entry
103464655         CDS       T05149                                 

Gene name
pck1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00020  Citrate cycle (TCA cycle)
pret00620  Pyruvate metabolism
pret01100  Metabolic pathways
pret03320  PPAR signaling pathway
pret04068  FoxO signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Module
pret_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103464655 (pck1)
   00020 Citrate cycle (TCA cycle)
    103464655 (pck1)
   00620 Pyruvate metabolism
    103464655 (pck1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103464655 (pck1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103464655 (pck1)
   04920 Adipocytokine signaling pathway
    103464655 (pck1)
   03320 PPAR signaling pathway
    103464655 (pck1)
Enzymes [BR:pret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     103464655 (pck1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 103464655
NCBI-ProteinID: XP_008407116
UniProt: A0A3P9P0J0
LinkDB
Position
LG5
AA seq 624 aa
MPPQIQSQNQSGLRVLQGELSALSPAVREFVETNVTLCQPESLHICDGSDQENRAILTQL
EEQGMIKKLTKYENCWLARTDPGDVARVESKTVIVTREQRETVPTPLGGGTSQLGRWMSP
EEFDKAMAQRFPGCMKGRTMYVVPFSMGPVGSPLSKIGVELTDSPYVVASMRVMTRMGKT
VLNELGNGEFVRCLHSVGCPLPLKKPLVNNWPCNPEQTLVAHIPERRQIISFGSGYGGNS
LLGKKCFALRIASRIAKEEGWLAEHMLILGITNPAGEKKYMAAAFPSACGKTNLAMLCPT
LPGWKVECVGDDIAWMKFDNQGNLRAINPENGFFGVAPGTSAKTNPNAMATIVKNTIFTN
VAETSDGGIYWEGMEQELPEGVTLTSWKNKPWSSEDGEPCAHPNSRFCTPASQCPIIDPQ
WESPEGVPIEAIIFGGRRPEGVPLVYEAFNWQHGVFVGAAMRSEATAAAEYKGKVIMHDP
FAMRPFFGYNFGQYLSHWLSMADRPGAKLPKIFHVNWFRKSPKAGFLWPGFGDNIRVLDW
MFRRVDGNTGAMPSAVGYLPCNNSLNLQGLEGKVNLSELFSLEHEFWQKEVEEVRKYFTT
QVNDDLPSEVACQLELLQQRVKQM
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgcctcctcagatccagtcacagaaccagagcggactcagggtcctgcagggcgagctc
agtgccctcagcccagcggtcagagagtttgtggagaccaatgttaccctgtgccaacca
gagtcccttcacatctgcgatggctcggatcaggaaaaccgagccatcctaactcagctg
gaggaacaagggatgatcaagaagctcaccaaatatgagaactgctggttggctagaaca
gacccaggggatgtggctagagtcgagagcaagacggtaatcgtgactcgggagcagagg
gaaacggtgcccacgccactgggaggtggaaccagccaactggggcgttggatgtccccg
gaggagtttgacaaagccatggctcaacggttccccggctgcatgaaaggtcgcaccatg
tatgtggttcccttcagcatgggccctgtcggttctcccctctccaagattggcgtcgag
ctgactgattccccctacgtggtggccagcatgagggtgatgacccgaatggggaaaact
gtgctcaacgaactgggaaacggcgagtttgtccgctgtttgcactccgtcggctgccct
ctcccacttaaaaagcccctggtaaataactggccctgcaaccctgagcagaccctcgtc
gcccacatcccagaacgcagacaaatcatctcatttggcagcggttacggcggaaactcc
ctcttgggaaagaagtgcttcgctctccgcattgcctcgcgcattgccaaggaagagggc
tggcttgctgagcatatgctgatcttaggcatcaccaatcctgctggagagaagaagtac
atggcagcagccttccctagtgcctgtggtaaaaccaacctggccatgctctgcccaaca
ctgcctggctggaaggttgagtgtgtaggagacgacatcgcctggatgaagtttgacaac
caaggcaacttgcgcgcaatcaaccctgagaatggattttttggtgttgcacctggtaca
tcagctaaaaccaaccccaacgccatggcaaccattgttaagaacaccatcttcacaaat
gtggcagaaaccagtgatggtggcatatactgggagggaatggagcaggaactgcctgag
ggagtaacgctcacatcatggaagaacaagccctggagttcagaagacggggaaccctgc
gctcaccccaactctcgcttttgcaccccagcaagtcagtgtcccattattgacccacag
tgggaatcaccagaaggagtccccattgaggccatcatctttggaggcaggaggccagaa
ggtgttcctctggtatatgaagccttcaactggcaacacggggtatttgttggtgcagca
atgaggtcagaggccactgcagcagctgagtacaaaggcaaggtaatcatgcatgacccc
tttgccatgcgacccttcttcggctacaacttcggccaatacctctctcactggctgagc
atggccgaccgtcccggtgccaagctgcccaagatcttccatgtcaactggtttcgaaag
agccccaaagctggcttcctctggcctggctttggagacaacatccgcgttttggactgg
atgttcaggcgagtggacggtaataccggcgccatgccttccgcggtgggctacctgccc
tgcaacaactccctgaacctccagggcctagagggaaaggtgaacctcagtgagctgttc
tccttggaacatgagttctggcagaaggaagtggaggaagtcaggaagtatttcaccaca
caggtgaacgatgacctgcccagtgaggtggcctgtcagctggagttgttgcagcagagg
gtgaagcagatgtag

KEGG   Poecilia reticulata (guppy): 103482322
Entry
103482322         CDS       T05149                                 

Gene name
pck2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [GTP], mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00020  Citrate cycle (TCA cycle)
pret00620  Pyruvate metabolism
pret01100  Metabolic pathways
pret03320  PPAR signaling pathway
pret04068  FoxO signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Module
pret_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103482322 (pck2)
   00020 Citrate cycle (TCA cycle)
    103482322 (pck2)
   00620 Pyruvate metabolism
    103482322 (pck2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103482322 (pck2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103482322 (pck2)
   04920 Adipocytokine signaling pathway
    103482322 (pck2)
   03320 PPAR signaling pathway
    103482322 (pck2)
Enzymes [BR:pret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     103482322 (pck2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 103482322
NCBI-ProteinID: XP_008436639
LinkDB
Position
LG20
AA seq 635 aa
MSCLLLGVIRRQGGVGASVGVRSLASIPSLPPTVADFVKGAVDECKPANIHVVTGTPEET
ANILAGLERDGMVKKLPKYENCWLARTDPKDVARVESKTVIVTKNQRDTIPIPAGGVKSQ
LGSWMSESDWQKARRDRFPGCMAGRTMYVIPFSMGPVGSTLSKYGVQVTDSPYVVASMGI
MTRMGSPVLQKLYEGEEFVRCQHSLGRPFPLKAPLVNSWPCNPDKVLISHLPDTRQIMSF
GSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYVAAAFPSACGKT
NLAMMKPAIPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSDKTNPYAMATI
SRNTVFTNVGETSDGGVWWEGLEHPAAGVTLTDWHGKTWKPGSSTPCAHPNSRFCAPASQ
CPIIDPQWESEEGVPIDAIIFGGRRPEGVPLVYESFNWQHGVFVGAAMRSEATAAAEHKG
KVVMHDPFAMRPFFGYNFGDYLAHWLSMQTRKAPTQLPKIFHVNWFRKDPATGAFLWPGF
GENARVLEWIFKRCGREREEEAAKKSYIGWLPEDGAINTKGLGSKVDMGALFDVPKPFWQ
KETKELRAYFTQQVGADLPAQVETELKALEDRVHA
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtcgtgccttttattaggagttatacgaaggcagggtggtgttggggccagtgtcggg
gtccggtctctggcctccatcccttctctaccgcctaccgtggctgattttgtgaaggga
gctgtggacgagtgcaagcccgccaacatccacgtcgtaaccggtactcctgaggaaacg
gccaacatcctggccggcctggaaagggacggcatggtcaagaagcttcccaaatacgag
aactgttggttggcccgtacagacccgaaggatgtggcccgggtggagagcaaaactgtg
atcgtaaccaaaaaccagagagacaccatccccatccctgctggaggggtgaagagccag
ctgggcagctggatgagcgagtcggactggcagaaagccagacgagaccgtttcccaggg
tgcatggcaggtcggaccatgtatgtgattcccttcagcatgggacctgtcggctcaaca
ctaagtaaatatggcgtccaggtgacagactcgccgtacgtcgtagccagcatggggatc
atgacgcgcatgggctcccctgttctgcagaaactgtacgaaggagaagagtttgtccgc
tgtcagcactcgttaggacgacctttcccgctcaaagctcctctggtcaactcttggcct
tgcaacccagacaaagtcctaatatctcacctgccggacaccaggcagattatgtccttc
ggcagcggttatggaggaaactctctccttgggaagaagtgctttgccctccgtattgcc
tctcgtattgccaaggatgagggctggctggctgagcatatgttgatccttggaatcacc
aaccctcagggcgtgaagcgctacgtggcggcggccttccccagcgcctgtggtaaaacc
aacctggccatgatgaagcctgctatccccggctggaaggtggagtgcgtcggggacgac
atcgcgtggatgaagtttgacagtcaaggcaaactcagggccatcaacccagagaacggg
ttcttcggagtcgctccgggcacttctgacaagaccaacccctacgccatggccaccatc
tccaggaacacggtgtttaccaatgttggcgagacgagcgacggaggagtgtggtgggag
gggctggagcaccccgcagctggggttacgcttaccgactggcacggcaaaacatggaaa
ccaggaagctccacaccatgtgcccaccctaactcacgcttctgtgccccggcgagtcag
tgccccatcattgacccccagtgggagagcgaggaaggggttcccatcgacgccatcata
tttggaggcagaaggcctgaaggagtccctctggtctacgagtcgttcaactggcaacat
ggagtgtttgttggagctgcaatgagatcagaggccacagcagctgcagagcataaaggt
aaggtggtcatgcacgacccgttcgccatgcgtccgttctttggctacaactttggcgac
tacctcgcccattggctgagcatgcagaccaggaaggcccccacccagctgcccaagatc
ttccacgtcaactggttcagaaaggaccctgccactggcgccttcctctggcccgggttc
ggagaaaatgcccgcgtgctggagtggatcttcaagcgctgcggcagagagagggaagag
gaagcagccaagaagagctacattggctggttgccagaagatggcgccatcaacactaaa
ggtctgggcagcaaggtggatatgggcgccctgttcgatgtgcccaaaccattctggcag
aaggagaccaaggagctgagagcgtacttcactcagcaggtcggagcggatctgcccgct
caggtggagacggagctgaaggcgttggaggacagagtccacgcttag

DBGET integrated database retrieval system