KEGG   Poecilia reticulata (guppy): 103465103
Entry
103465103         CDS       T05149                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
pret  Poecilia reticulata (guppy)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 103465103
NCBI-ProteinID: XP_008407884
UniProt: A0A3P9NTJ8
LinkDB
Position
LG5
AA seq 358 aa
MTNCELIELKDLSVNDSIELAAPPAHVASAPVHPGQPGAGRVVRLVGDSVSIEGPVRHLG
EGAVGHDFQPFSYTHLSWCDLCGEFIWGLYKQSLRCANCSYTCHHRCRPFIQLDCSTQGS
ALTENADYSEDSIETDTNVDDQTEPGKQELSVGKIQQKVKEYNAQINNNLYMVDNKDGTY
TGFIKVHFQLLRPISLPPSRNQSWTEEDDQQERLTRRRTSFYLPKDAAKHLHVSSETRVR
EVIEALLNKFTVVDNPAKFALFERAEKQSQVFVRKLSDDERPLYLRLCAGPSESVLSLVL
KENETGDVNWDAFSFPELNNFLRILQREEEEHVRQIVKRYAHARDMIRHAMARVTTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgactaactgtgagctgatcgagctgaaggacctcagtgtgaacgattccatcgagcta
gccgccccacccgcacacgtcgcctcagcccctgtccatccgggccagcccggcgctggc
cgcgtcgtccgtctggttggagacagtgtcagcatcgagggaccggtccgtcacctggga
gagggggcggtgggccatgacttccagccctttagctacacgcacctcagctggtgtgac
ctgtgtggagaattcatctggggtctctataagcagagcttacgctgtgccaactgcagc
tacacttgtcaccaccgctgccgaccgtttatccagctggactgcagcacacaggggagt
gcgttaacggagaacgcagactacagcgaggactccatcgagacggacacaaacgtggat
gaccagactgaaccgggtaaacaagagttgagtgtcggtaagattcagcagaaggtgaag
gagtacaacgctcagatcaacaacaatctctacatggtggataataaagatgggacgtac
actggtttcataaaggtccactttcagttgcttcggcccatctccctcccaccttctcgg
aaccagagctggacagaggaggacgatcagcaggaaaggctgacaaggcggcggacgtct
ttctacctccccaaagacgcagcaaagcaccttcacgtgagctcggaaacccgagtgcga
gaagtcatcgaggcgttgctcaacaagttcactgtggtcgacaatccggcgaagtttgcc
ctgtttgaacgtgctgagaagcaaagtcaagtgttcgtgcgcaagctgtctgacgacgag
cgcccgctgtatttgcgcttgtgtgctggccccagtgagtcagtcttgagtctggttctg
aaggagaatgaaacaggggatgtaaattgggatgccttcagcttcccagagctgaacaac
tttctgcgaatcttacagcgcgaggaagaagagcacgtgcggcagattgtgaagcgctac
gctcacgctagagacatgataaggcacgcaatggcccgcgtaaccacccctggttga

DBGET integrated database retrieval system