KEGG   Poecilia reticulata (guppy): 103465156Help
Entry
103465156         CDS       T05149                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00020  Citrate cycle (TCA cycle)
pret00190  Oxidative phosphorylation
pret01100  Metabolic pathways
pret01200  Carbon metabolism
Module
pret_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pret_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pret_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103465156
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103465156
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103465156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 103465156
NCBI-ProteinID: XP_008407994
LinkDB All DBs
Position
LG5
AA seq 283 aa AA seqDB search
MSVATFTSLSRCSVSAFRSPAGLLAVRYAQTAAAAAVQPRIKKFQVYRWDPDTPGDKPRM
QTYEIDLNTCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACLNKID
TNLSKPTKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKRDDSKEGKEQYLQSMEDRQ
KLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLSKLQDPF
SLYRCHTIMNCTKTCPKGLNPGKAIAEIKKMMATYKEKKAAAV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgctacctttacgtccttgagccgctgcagtgtttcggctttccgctctcct
gccggactgctggcagtgcggtatgcccagacagctgcagccgcagctgttcagcccaga
ataaagaagttccaggtgtacagatgggacccagacacacctggagacaaaccccgcatg
cagacgtatgagatcgacctcaacacatgcgggccgatggtccttgatgccctcatcaaa
ataaaaaatgagatggattcgactctgaccttccgccgttcatgtagagaaggtatttgt
ggatcctgtgcgatgaacataaacggaggaaacacgctcgcctgtctcaacaagattgac
accaacctcagcaagccaaccaagatttacccacttccacacatgtatgtggtcaaggac
ctggtgcctgacatgagtaacttctacgcccagtacaagtccatcgagccgtacctgaag
aagagggacgactcaaaggaggggaaggagcagtacctgcagtctatggaggacagacag
aagctggacggcctgtatgaatgcatcctgtgcgcttgctgcagcaccagctgtcccagc
tactggtggaacggagacaaatacctcgggccggctgtcctcatgcaggcgtaccgctgg
atgatcgactcacgagacgagttcacagaggagcgtctgtccaagctgcaggatccgttc
tccctctaccgctgccacaccatcatgaactgcaccaagacctgcccaaagggcctgaac
ccaggaaaagccatcgctgagatcaagaagatgatggccacatacaaggagaagaaagca
gcagccgtttga

DBGET integrated database retrieval system