KEGG   Poecilia reticulata (guppy): 103465183
Entry
103465183         CDS       T05149                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04110  Cell cycle
pret04115  p53 signaling pathway
pret04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103465183
   04068 FoxO signaling pathway
    103465183
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103465183
   04115 p53 signaling pathway
    103465183
   04218 Cellular senescence
    103465183
SSDB
Motif
Pfam: CDI DUF2576
Other DBs
NCBI-GeneID: 103465183
NCBI-ProteinID: XP_008408025
UniProt: A0A3P9N9L5
LinkDB
Position
LG5
AA seq 156 aa
MAPHKSMLSSLGGNRQARRNLFGPVDRDQLQVEYKAALRKDLDEASRRWGFDFKSNKPLE
SSDFKWEGIPETRVPLLYRSCVLAEGLGLAGRAVRTKPARVEKENIPQMPEKWDLEDLEK
TPEKGDKAVLKRKQTNITDFYQAKRRVVWMPRKSGE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggctcctcacaagtcgatgctgagctccctaggggggaacagacaggcccgcaggaac
ctgttcggccctgtggaccgagaccagctgcaggtggagtacaaggcagcgctgcgcaaa
gacctggacgaagcgtccagacgatggggctttgacttcaagtcgaacaagcccctggaa
agcagcgacttcaagtgggagggcatcccagaaaccagggtgccactgctctacaggtcc
tgcgtgctggcagagggcctggggctggcaggacgggctgttcggaccaaaccagcaagg
gtggagaaggagaacatccctcagatgccagagaagtgggacctggaggacctggagaaa
acgccggagaagggagacaaagctgtgctgaagaggaaacagacaaacatcacagatttc
tatcaggccaagagacgagttgtgtggatgccgaggaaatccggggagtga

DBGET integrated database retrieval system