KEGG   Poecilia reticulata (guppy): 103465382
Entry
103465382         CDS       T05149                                 

Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta isoform X1
  KO
K11221  signal transducer and activator of transcription 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04217  Necroptosis
pret04621  NOD-like receptor signaling pathway
pret04625  C-type lectin receptor signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103465382
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103465382
   04625 C-type lectin receptor signaling pathway
    103465382
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103465382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103465382
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103465382
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 EF-hand_12 SRP68
Other DBs
NCBI-GeneID: 103465382
NCBI-ProteinID: XP_008408363
UniProt: A0A3P9PSZ7
LinkDB
Position
LG5
AA seq 798 aa
MAQWDRLRQLSATYLQQLNELYDRDGLPMDVRHYLSAWIEKQEWQRAARDYDVAMVLYQV
LLENLDIQHSRFVQEESFLQQHNIRRYKQSFQRHQDEPCVLASTIQWFLDKEKEILNSAE
LSEQVQLLQVEQEAMETTCQQELQRKMAGLRNDVQCLEHAIICLEEQQDEFDFKYQTHKM
EAVTDEAQKNERMKMFQSLINKLNDYRKNTLADLNKLLDRAEDLINLLVRKELVDWQRRQ
QKSCIGAPDNVCLDQLEKWFTCVAVCLFQVREFLNKLDELVGKMSYENDPIKAQKPALNN
RTDALLKDLLKSSFVVETQPSMPQGKGPLVLRTNVQFSVKTRLLVKFAELNHSMKVKVSM
SREAPQIKGYRRFNVLGTATKDLNMAESLSGGMVADFRHLSLKEQKSGGGGKGISEISLS
VTEELHIIYFNTVFDLKGFSVELQASSLPVVIISNSSQQQSAWASILWFNMLSLDPKDVM
FFGTVPAAPWPQFGEMLSWQFLSATKRGLDDDQRKMIAHKLFGKQQNYDICQVTWSKFSK
ENGPDTFWVWFDGILVMVKTYLENIWREGLIMGFVSRGKEKLLLKKKKRGTFLLRFSESV
VGGITFSWVEMDSTGEPDIKTVQPFTKTDLCQIPFHEIIRNFQILEAENIPESPLLFLYP
DTPKDEAFGKWYNGKTGADNPYMKYIKTKLMFVSKENSLEARSPMSCDMTQGDCLEPMNG
LYGEAAEQEDEPRLLQSQLETFQDPMLSSSLPLDDDGLLYMSFTDSDFIQQPDQFLTDFN
NLLAPSLLPAQTCGGIFQ
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggcccagtgggacagactgaggcagctctctgctacttacttgcagcagcttaatgag
ctgtatgacagggatggtttgcctatggatgttcgccactacctgtcggcttggatagag
aagcaggagtggcaacgagcagctagggactacgatgttgcaatggtgctgtaccaggtt
ctgctggagaatctggatatccagcacagccgctttgttcaggaggagtcattcttacag
cagcacaacatcagacgctataaacaaagcttccagaggcatcaagatgagccctgtgtt
ttggcaagcacaatccagtggtttctggacaaagagaaggaaatcctgaacagtgccgag
ctgagtgaacaggtgcagcttttgcaagttgagcaggaagccatggagacgacctgtcag
caggagcttcaacgcaaaatggctggactgagaaacgatgtgcagtgtttagaacatgcg
attatatgcctggaggagcagcaagatgagtttgattttaaatatcaaacccacaagatg
gaagctgtgacagatgaggcacagaagaatgaacggatgaaaatgtttcagtcactaatc
aacaaactgaatgactatagaaagaacactctagcagacttgaacaagcttttggaccgg
gctgaagacctgatcaatctgttggtgcggaaagagctggtggactggcagaggaggcag
cagaaatcctgcatcggcgctccagacaatgtttgcctggatcagctggagaaatggttc
acctgcgtggcagtgtgtctgttccaggtccgggagtttctcaataagctggatgagttg
gtgggaaaaatgtcctatgaaaatgaccccataaaggcccaaaaacctgcactgaataac
agaactgatgcacttcttaaagacttactcaagagttcgtttgtggtcgagactcagccg
tccatgcctcagggaaagggccccctggttttgcgtacaaatgtccagttctctgttaag
acaagacttctggttaagtttgctgaactgaaccactccatgaaggtgaaagtatccatg
tcaagggaggctcctcagatcaaaggatatcggcgcttcaatgtgctgggaactgcaacc
aaagatttgaacatggctgagagtctcagtggaggcatggttgcagacttcagacatctg
tctctgaaggagcagaagtctggaggaggtggaaaaggaatcagtgagatttctctgagt
gttacagaggagctgcacatcatctacttcaacactgtctttgacctgaagggcttttca
gtggagctgcaggcctcctcccttcctgtggtcatcatatcaaactccagccagcagcaa
agtgcctgggcgtctatcctctggttcaacatgcttagcttggatccaaaggatgttatg
ttcttcggcaccgttcctgcagctccttggccgcagtttggagagatgttgagctggcag
tttctctctgccacaaaacgtggtctggatgatgatcagcgcaaaatgattgcacacaag
ctgtttgggaagcagcagaactacgacatctgccaagtgacgtggtcaaagttttcaaag
gaaaatggtcctgacactttctgggtgtggtttgatggcatcctggtgatggtgaaaacc
tacctggagaacatctggagggaaggcctcattatgggttttgtgagcagaggaaaagaa
aaactgcttctcaagaagaagaaaagaggcactttcttgttgcgcttcagtgaaagtgtg
gtgggaggaatcaccttctcctgggtggaaatggactcaactggtgagcctgatataaaa
acagtccagcccttcacaaaaactgacctctgccagatcccattccacgaaattatcagg
aatttccagatcttggaagccgaaaacatcccggaaagtcctctacttttcctgtatccc
gacactccaaaagatgaagcttttggaaagtggtacaatggcaagactggagctgacaat
ccttacatgaagtacatcaaaaccaagctgatgtttgtttctaaagagaactcactggaa
gctaggtcacccatgtcctgtgacatgacacagggcgattgtctggagccaatgaatggc
ctgtatggagaggcagctgaacaagaggatgagcctcgtcttctgcagtcacagctggaa
acctttcaggatcccatgctgagcagctctctgcccttggacgacgatggtctgttgtac
atgagcttcaccgattctgacttcatacagcagcccgaccaattcctgactgatttcaac
aaccttttagcacccagcctcctgcctgcacaaacctgtggaggcattttccagtag

DBGET integrated database retrieval system