KEGG   Poecilia reticulata (guppy): 103465429Help
Entry
103465429         CDS       T05149                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00240  Pyrimidine metabolism
pret00983  Drug metabolism - other enzymes
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    103465429 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103465429 (tk1)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     103465429 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK Ribosomal_L40e ATPase_2 AAA_14 zf-CCHC_3
Motif
Other DBs
NCBI-GeneID: 103465429
NCBI-ProteinID: XP_008408465
LinkDB All DBs
Position
LG1
AA seq 234 aa AA seqDB search
MDFLDSPVCPIRLQNSPKKSRGQIQIIFGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAK
DIRYSDSGMATHDKNTMEAVPATCLGDVRSAALNACVIGIDEGQFFPDTVEFCEEMANLG
KTVIVAALDGTFQRKPFGNILNLVPLAESVVKLHAVCMQCYKEAAYTKRLGAEQEVEVIG
GADKYQAVCRKCYGGLVVDKENSSSIRNETPLQVPLGKLADPNVPRKLFSPLHL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggacttcctcgattcgccagtttgtccaatcaggctacaaaactcaccgaagaaatcc
cgtggacagattcagattatatttgggccgatgttttcaggcaaaagcaccgaactgatg
agaagagtgcgccgtttccaggtggcccagtacaaatgtttggtcatcaaatatgccaaa
gacatccggtattcagactcgggtatggccacacatgacaaaaacaccatggaggccgtg
cctgccacctgcctgggggacgttcgctccgccgcgctgaatgcctgcgtcatcgggatc
gacgaaggacagttttttccagataccgtggagttttgtgaggagatggccaatttgggg
aagacggtcatcgtggctgcgttggatgggaccttccagaggaagccttttggaaacatc
ctgaacctggttcctcttgcagaaagtgtggtgaagctccacgccgtctgcatgcagtgt
tacaaagaagccgcctacaccaagaggctcggagcagagcaggaggtggaagtgatcggc
ggtgctgacaagtaccaggcggtgtgcagaaagtgctacggcggtctggtggtggacaaa
gagaacagctcctctatcaggaacgagacgccgcttcaggtcccgctgggaaaactcgcc
gaccccaacgttccccggaaactgttctcccctctgcacctctga

DBGET integrated database retrieval system