KEGG   Poecilia reticulata (guppy): 103465622
Entry
103465622         CDS       T05149                                 

Gene name
kitlg
Definition
(RefSeq) KIT ligand precursor
  KO
K05461  KIT ligand
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103465622 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103465622 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pret04052]
    103465622 (kitlg)
Cytokines and growth factors [BR:pret04052]
 Growth factors
  Growth factors (RTK binding)
   103465622 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 103465622
NCBI-ProteinID: NP_001284393
UniProt: R4QRG2
LinkDB
Position
LG6
AA seq 270 aa
MKKSKSWIDVCVHFLLFMTLGVHSAATGKVVNDIDRRVPDLRQNIPKDYKIPIKFIPKET
GDMCWAKLNLYYLEESLKDLSEKFGNISSNNLNIQILIQFIEEKRIGISNMDTQMLEFEC
HYRDDKWETGKYFNFVEEVCNTADRERLEEECDPPPCPTTPIPTEESSSAQYTSGQDTSH
SIATKEIARSSASLPSPLRQVVEKSLFSLLFIPLLALIFLLVWKVRSRRNVEHPRSNRGE
EEGFTEPDPMAPQPDSETSEKNALNIPTEV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatagacgtctgtgtccatttcctgctgttcatgacgctt
ggggtacattcagctgcaactggaaaagtggtcaatgatattgacagaagagtccctgat
ttgagacaaaatattccaaaagattataaaatccccatcaagttcattcccaaagaaacg
ggcgacatgtgttgggcaaagttaaacctttactacttggaggagagcttgaaggattta
tctgaaaagtttggaaacatttcatctaataatctcaacatacaaatactcatccaattc
attgaagagaagcggataggaatcagtaatatggatacacaaatgttagagtttgagtgc
cactacagagatgataagtgggaaacagggaaatactttaactttgtcgaggaggtgtgt
aatactgcagacagagaaagacttgaagaggaatgtgatccacctccctgtcccaccaca
ccgataccaacagaagaatcctcttcagctcagtatacgtcaggccaagacacgtcacac
agtatcgctactaaagaaatagcgcgctcatcagcttcgttgccaagtccccttcgccag
gtggtggagaaaagccttttctccttactgtttatcccactgctggccctaatcttcctg
cttgtgtggaaggtcaggtcaagaaggaacgtagagcatcctcgatcaaatcgtggagaa
gaagaaggcttcacagaaccagatccgatggcacctcagccggacagtgaaacgtcagaa
aaaaatgcgctgaacatccccacagaagtgtaa

DBGET integrated database retrieval system