KEGG   Poecilia reticulata (guppy): 103465909
Entry
103465909         CDS       T05149                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04012  ErbB signaling pathway
pret04068  FoxO signaling pathway
pret04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103465909
   04068 FoxO signaling pathway
    103465909
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103465909
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103465909
NCBI-ProteinID: XP_008409347
UniProt: A0A3P9P5C7
LinkDB
Position
LG6
AA seq 194 aa
MKTGRSWLLEDSAFLGGKMSDVRLSNGSPTLERTEPRVMEHPKPSACRSLFGSVDHEELK
RDLKGHMLELQEAASAKWGFDFASDEPLPNARLTWELVDPAEVPDFYVRPPRREKGVCSG
NNNVDLNGNHSCDTSMSDVLTECTEQCTGLRKRPCHDTTAQSKRSRSSPDEVSCPTLSHS
VEHTPRKSSPKRQT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaaaaccggacgctcctggctgctcgaagattcagcttttttggggggtaaaatgtca
gacgttcgactttcaaacggaagcccgacgttggaacggacggagccccgggttatggaa
cacccgaagccgtcagcctgccgaagcctcttcggctcggtggaccacgaagagttaaag
agggatttaaagggacatatgctggagctgcaggaggctgcgtccgccaagtggggcttc
gactttgccagtgacgagccgctgcctaacgccaggctcacatgggaactagtggacccc
gctgaggtcccggatttctacgtgcggcccccgcggagggagaaaggcgtctgctctggg
aataacaatgtggatctaaacgggaatcatagctgcgatacgagcatgtctgacgtactg
actgagtgtacggagcagtgcaccgggctgaggaaaagaccttgtcacgacaccacggcg
caaagtaagaggtcacgcagcagcccagatgaagttagctgtccaaccctgagccactct
gttgaacacacacccagaaagtccagtcccaagaggcaaacgtga

DBGET integrated database retrieval system