KEGG   Poecilia reticulata (guppy): 103466039
Entry
103466039         CDS       T05149                                 

Gene name
cpt1b
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00071  Fatty acid degradation
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103466039 (cpt1b)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103466039 (cpt1b)
   03320 PPAR signaling pathway
    103466039 (cpt1b)
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103466039 (cpt1b)
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103466039 (cpt1b)
SSDB
Motif
Pfam: Carn_acyltransf CPT_N Sigma70_r2 DUF3128
Other DBs
NCBI-GeneID: 103466039
NCBI-ProteinID: XP_008409562
UniProt: A0A3P9PKM0
LinkDB
Position
LG6
AA seq 787 aa
MAEAHQAVGFEFTVRPDGVDVKLTKEVLKNIYLSSLTAWKKKAIRLKNGILTEVYPASPS
SWLIVVIAMMMSLYTGTDPPLGIIDTIKKNLPYQDFLSAQARAVVSAILFATAVWLFFIH
IIRFALKTLLSYHGWIFETHGNMRTTTKVWLRLVRLLSGRRPLLYSFQAALPRLPVPRVK
DTIEKYLESVRPLLDDDQYKRMEVLARNFKENEASQLQRYLVLKSWWSTNYVSDWWEEYI
YLRSRGPIMVNSNFYIMDLLYVTPTHRQAARAGNIVHAMLQYRRKLERGELAPMRALGTV
PMCSTQMERMFNTTRIPGTETDFVLHLTDRKHLVVFHRGRYFQVWLYTGGRHLLPSELEN
QFQQILNDTSEPQPGELKLAALTAGDRVPWARTRLKYFSKGPNKESLDTIESASFFLTLD
EKPQGYDPGKAFSLDTYAKSLLHGKCYDRWFDKSFNLISYPNGKMGVNIEHSWADAPIVG
HMWEYVLAIDCFHLGYTEEGHCKGDVNRGLPSPTRLKWEIPEKCQDIIHASYVLARHLAD
DVDFHGHLFTEFGKGLIKKCKTSPDAFIQMALQLAQFRDQGVFCLTYESSMTRMFRDGRT
ETVRSCTCEAAAFVLTMEHQDATNAERLALFRKAADKHQNMYRLAMTGSGIDRHLFCLYI
VSKYLGVESPFLTKVLSEPWKLSTSQTPQQQINLVDIDKFPKYVGAGGGFGPVADDGYGV
SYIIVGENLITFHISSKFSRRNTDSARFGQHIRKAMIDIQTLFKQEKDKSVVENGKDVHL
ENNKKYM
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgaggcccatcaggcagtgggcttcgagttcactgtgcgcccagatggtgtggat
gtgaagctgactaaggaggtcctcaaaaacatctacctgtcttcactcactgcctggaag
aagaaagccattaggctgaagaatggaatactgactgaagtttacccagccagtccgtcc
agttggttgatagttgtgattgccatgatgatgtccttgtacactggcacagacccccct
ctaggaataatagataccatcaagaaaaacctgccttaccaagactttttgtcagcgcag
gcgagagcagttgtgagcgccatcctgtttgccacggcagtatggctgttcttcatccac
atcatacgattcgctctaaagactcttctttcctaccacggatggatttttgaaacccat
ggaaatatgaggacaactacaaaagtgtggctgagactggtaaggttgctctctggacga
aggcccctgctctacagcttccaggctgccttaccccgactccccgtccctcgagtgaaa
gacaccattgagaagtatcttgagtcagtgcgccctctgctggacgacgatcaatacaaa
cgaatggaagttttggcacgtaactttaaagaaaacgaggcatctcagctccaaaggtac
ctggtgctaaaatcctggtggtcaacaaattatgtaagtgactggtgggaggaatacatc
tacttaaggagcagaggtccaataatggtcaacagcaacttttacatcatggaccttttg
tatgtgaccccaacgcaccgtcaggctgcccgagcaggaaacatagttcatgccatgctg
cagtacaggcgcaagctggagcgtggtgaacttgcaccgatgagggctttagggaccgtt
ccgatgtgttccactcagatggagagaatgtttaacaccactcgtatccctggtacggaa
acagattttgtactgcacctgacagaccgaaagcacctcgttgtcttccacagaggccgc
tactttcaagtgtggttgtatacgggggggcgccacctcttacccagcgaactggagaac
cagtttcaacagattctcaatgacacgtcagaaccgcagccaggagaactgaaactagct
gccctcactgcaggagacagagtaccttgggcacggactcggcttaaatattttagcaag
ggaccaaacaaggaatccctggataccattgagtctgcctcattcttcctgacactcgac
gaaaagccacagggttatgatccaggaaaggctttctcacttgacacttatgccaaatcc
ctactgcacggcaaatgttacgacaggtggttcgacaagtctttcaacttaatttcatat
ccaaatggaaagatgggagtcaatattgagcactcttgggctgatgcacccattgttgga
cacatgtgggagtatgttcttgcaatagactgctttcatcttggctacacagaggaggga
cattgtaaaggggatgtgaacaggggccttccttctcccactcgactaaagtgggagatt
ccagaaaagtgccaagatatcattcacgcttcatacgtgttagccagacacctagctgac
gatgtggacttccatggccatctgttcactgagtttggcaaaggcctgatcaagaagtgc
aagacgagccctgatgccttcattcagatggctctgcagctcgcacagttcagggatcaa
ggtgtgttctgtctgacgtacgagtcatcaatgacccgtatgttcagagatgggcggacg
gagacggtgcgctcctgcacctgcgaggctgctgcttttgtcctgaccatggagcatcag
gatgcaacaaatgccgagagacttgcgctgttccggaaagcagcagacaagcatcagaac
atgtatcgtctggccatgaccggttccggtatcgatcggcatctcttctgcctttacata
gtatctaaatacctcggtgttgaatcaccatttctcacgaaggtgctttccgagccgtgg
aagctgtccaccagtcagactcctcagcagcagattaatttagttgatatcgacaagttt
ccaaaatacgtgggtgcaggaggcggatttggacctgtggctgacgatgggtatggtgtt
tcttatatcattgttggggaaaatctcattacattccacatctccagcaaattctccagg
cgtaacacagactccgctcggtttggtcagcacattcggaaagccatgattgacatccag
actcttttcaagcaagaaaaagacaagagcgtggtggagaatggaaaggatgtgcatttg
gaaaataataaaaagtacatgtag

KEGG   Poecilia reticulata (guppy): 103466156
Entry
103466156         CDS       T05149                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00071  Fatty acid degradation
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103466156
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103466156
   03320 PPAR signaling pathway
    103466156
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103466156
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103466156
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 103466156
NCBI-ProteinID: XP_008409769
UniProt: A0A3P9Q5S2
LinkDB
Position
LG6
AA seq 772 aa
MAEAHQAVAFQFTVGPDGIDLHLCHEALRQVYLSGLHSWKKRFVRFKNGVMTGVYPGSPA
GFMVVVVSYMSYNRYKQLDPSMGLIARLGQHIPISRYMSTNSQRIVGGVLVGTGLWVTII
MIMRSVLKTLLSWHGWMESRHGSLPFGTRLWLILVKVFSGRKPLLYSFQNSLPRLPLPSV
QDTCRRYLESVRPLMDDEQFERMKALSKDFEKNLGPRVQWYLKLKSWWASNYVSDWWEEY
IYLRGRGPIMVNSNYYAMDFLYVFPTFRQAARAGNAVHAIMLYRRKLDRAQITPIYLLAN
KVPLCSAQWERMFNTSRIPGVETDTLQHMNESKHIAVYHKGRFFKVWMFYDGRLLLPREI
EQQMQRILADESEPMPGEEKLAALTAGERTPWAKAREQFFKSGKNKQSLDAIEKAAFFVS
LDDTEQRYDADNQVQSLDCYAKSLLHGKCYDRWFDKSFNLIVYKNGTMGLNAEHSWADAP
IVGHLWEHVLSMDPKLGYTEDGHCQGNPHPNLPGPQRLQWDMSKECQETIESSLRVARAL
ADDVDCHIIPFNDFGKGLIKKCRTSPDAFIQIALQLAHFRNKGKFCLTYEASMTRLFREG
RTETVRSCTMETCDFVRSMVRQETREERLRLLKVAAEKHQDMYRLAMTGQGIDRHLFCLY
VVSKYLGEESPFLKEVLSEPWRLSTSQTPLQQVELFDLARHPELVSSGGGFGPVADDGYG
VSYIILGEELINFHISSKYSSPETDSRRFGDNIRQSMLDILGLFQLENKASI
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggcagaagcgcatcaggcggtggcctttcagttcactgtcggccctgatggtatcgac
ctacatctgtgccacgaggccctacgccaggtctacctctctggcctccactcctggaag
aaaaggttcgttcgcttcaagaatggggtaatgactggtgtgtacccgggcagcccggct
gggttcatggtagttgtcgtgtcatacatgtcctacaacagatacaaacaactggatcct
tctatgggattgattgccagacttggccaacacatacccatcagccgatacatgtccaca
aatagccagaggatagttggaggggttctggtgggcacgggcctctgggtcaccatcata
atgatcatgaggagtgtcctgaaaaccctgctgtcatggcacggctggatggagtcgcgc
cacggctctctgccgtttggtactcgtttgtggctgatattggtgaaggtgttctctggc
agaaagccattgctctacagtttccagaactcactgcctcggctacctcttccttctgtc
caggacacatgcagaaggtacctggagtcggtgcgcccactgatggatgacgagcagttt
gaaaggatgaaggccttgtcaaaagactttgagaagaatctgggacccagggtgcagtgg
tacctcaaactcaagtcctggtgggcatccaactatgtcagtgactggtgggaagagtat
atttacctgagaggccgtggacccatcatggtcaacagcaactattatgccatggacttt
ttgtacgtgttccccacgttcaggcaggctgcccgggccggtaatgctgttcatgccatc
atgctctacaggagaaaactggacagagctcagatcacaccratatacttgctggccaac
aaggtgcctctgtgttctgctcagtgggagcgaatgtttaacacctcccgcatccctggt
gtggagacagatactctccagcacatgaacgagagcaaacacattgctgtgtaccacaag
ggccgtttcttcaaggtgtggatgttttacgacggacggctgctgttgccacgggagatc
gagcagcagatgcagaggatcttggcagacgagtctgagccgatgccaggagaggagaaa
ctggctgcacttactgcaggagaaaggaccccatgggcaaaggcccgagagcaattcttc
aaaagtggtaaaaacaagcagtccctggatgccatcgagaaggcggccttctttgtaagc
cttgatgacaccgagcagcgatatgatgcagacaaccaagtccagtctctggactgttac
gccaagtccctgctccatggaaagtgctacgacaggtggtttgataagtccttcaatctg
attgtctacaagaacggcaccatgggactaaacgcagagcactcctgggctgatgctcca
atcgttggtcatctgtgggagcacgtactgtccatggatcctaagctgggctatactgag
gatggtcactgccaagggaaccctcacccaaaccttcctggtccccagaggctacaatgg
gacatgtccaaagagtgtcaggagaccattgagagctcactgagggtagccagggctctg
gcagacgacgtggactgccacataatccccttcaatgacttcggaaagggtctgattaag
aagtgccgcaccagtccagacgccttcatccagattgccttgcagctggcccatttcaga
aacaaagggaagttctgcctgacatacgaagcttccatgacacgactcttccgtgagggt
cgaacagaaaccgtgcgttcctgcaccatggagacctgcgactttgtccgttccatggtc
agacaggagacgagagaagagcgcctcaggttgcttaaagtggcagcagagaaacaccaa
gacatgtaccgcttggcaatgacggggcagggcatcgaccggcaccttttctgtctctat
gtggtttctaaataccttggagaggaatcgcccttcctcaaggaggtcttgtctgagcca
tggaggctgtccaccagtcagacccctctacagcaggttgagttgtttgacctggccaga
catccagagctggtgtcctctggaggcggattcggtccagtggctgatgatgggtatggt
gtctcctacatcatcctcggtgaggagctcatcaacttccacatctccagcaaatactca
agtccagaaactgattcacgtcgtttcggtgacaacatcagacagtccatgctggacata
ctaggtctcttccagctagagaacaaggcgtccatctga

KEGG   Poecilia reticulata (guppy): 103468298
Entry
103468298         CDS       T05149                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00071  Fatty acid degradation
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103468298
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103468298
   03320 PPAR signaling pathway
    103468298
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103468298
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103468298
SSDB
Motif
Pfam: Carn_acyltransf CPT_N
Other DBs
NCBI-GeneID: 103468298
NCBI-ProteinID: XP_008413488
UniProt: A0A3P9P803
LinkDB
Position
LG8
AA seq 788 aa
MAEAHQAVAFQFTITPEGIDLQLSYQALNQIYLSGVRSWKKRVSRMKNRVIKGVYPASPS
SWLFVAIGILATMYMQSDPSMGLIAKIQQHLPLSLHVSLSSQGQTMVSALVFSTLLWLSL
ILALRFCLKLLLSYHCWMFEQHGRVSNTTKVWVTLMSLFSRKKPLLYSYQTSLPHLPVPG
IQDTLSRYLESVRPLLTDSEFQQMTKLANEFESTLGHRLQRYLKLKALWATNYVSDWWEE
YVYLRSRGPIMVNSNYYGMDFLYVTPTSVQAARAGNTITALMLYRRKVNREELTPSRVPG
TVIPLCAAQCERMFNTTRTPGVETDVLQHWQDSEFVAVYHRGRYFRLWVYRAGRLLSPRE
IEYQIQRILDDSSPPFPGEEKLGALTAGDRIPWAQMRQQFFRSGLNKKSLDAIEKAAFFI
TLDDEEQGMKGDDPAGNLDRYAKSLLHGKCYDRWFDKSFSIVIYKNGKSGLNAEHSWADA
PTVAHLWEYTLATDAFQLGYTEEGHCKGEVDLSLPLPQRLVWEISPEVQTQVCSSLAVAQ
ALADDVDCHVFPFRDFGKGRIKKCRISPDAFIQLSLQLAYYRDRGGFCLTYEASMTRLFR
EGRTETVRSCSKDSCAFVRALESGQTEEECRRLFRLASEKHQNLYRMAMTGAGIDRHLFC
LYVVSKYLGVDSPFLHKVLSEPWRLSTSQTPVQQLELFDLKNNPDYISLGGGFGPVADDG
YGVSYIIVGEDLINFHVSSKHSCSETDSHRFGAQIQKAFQDIMALLSADAKSSSSSKGSN
QPQSKKLL
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcggaggctcatcaggcagtagcgttccagttcaccatcacaccagaaggcatcgac
ctgcagctgtcctaccaggccctgaaccagatctacctgtcgggggtccggtcctggaag
aagcgagtcagccgcatgaagaacagagtgataaagggagtgtatcctgctagcccgtca
tcgtggctgtttgttgccatagggatcttggctaccatgtacatgcagtctgatcccagc
atggggctcatcgcaaagatacagcagcatcttcctctgagtctgcatgtttctctgagt
agtcagggtcaaaccatggtgtcagctctggtcttcagcaccctgctgtggctttccctc
atccttgccctgcgcttctgcctcaagctgctgctctcctaccactgctggatgttcgaa
cagcatgggagagtctccaacaccaccaaagtctgggtgactctaatgagtttattttca
agaaagaagcctttgctgtacagctatcaaacctccctccctcatctcccagttcctggc
atacaagacactctgagcaggtatctagagtcagtgcgccctctgctgacggattcagag
tttcagcaaatgactaagttggccaatgagtttgagtcgacccttggacaccgactgcag
cgctacctaaaactcaaagctctgtgggccaccaactatgtgagcgactggtgggaggaa
tacgtctacttgaggagtcgagggccaataatggtcaacagtaattactatggcatggac
ttcctgtatgtgacgccaacatcagttcaggcggcgcgagctggaaacaccatcactgct
ctcatgctctaccgacgcaaagtaaacagagaggagctcacaccgagtcgtgttccgggc
accgtgatccctctgtgtgcagctcagtgtgagcggatgttcaacaccacgcgaacacca
ggagtcgagactgatgtactccagcattggcaggacagcgagtttgtggcggtgtaccac
cgggggcgttatttccggctgtgggtgtaccgggcgggccggctgctgtctcccagagag
atcgaataccagatacagagaatcctggacgactcttcaccaccgtttcctggagaagag
aaactgggagctctgacagctggagacaggatcccctgggctcagatgcggcagcagttc
ttcagatcgggcctcaataagaagtctctggacgccatcgagaaggcggcgttcttcatc
acgctggacgacgaagagcagggcatgaagggagacgacccggcggggaacctggatcgc
tacgccaagtctttgctccatggcaaatgttacgacaggtggtttgataaatccttctcc
atcgtaatctacaaaaacgggaagagcggcctgaacgcagagcactcctgggccgatgcg
ccgacagtggcccatctgtgggagtacactctggctacagacgccttccagctgggctac
actgaagaaggacactgtaaaggagaggtggatctttcgctgccgctgcctcagaggctg
gtgtgggaaatctctccagaggtccagactcaggtctgcagctccctggcggtggcccag
gctttggctgacgatgtggactgccacgtcttccccttcagggatttcggaaagggtcgg
atcaagaagtgccggatcagccccgatgcgttcatccagctcagcctgcagcttgcctac
tacagggaccgtggtggtttctgcctgacgtacgaggcgtctatgacccgtctgttcagg
gagggccgcacagaaacggtgaggtcttgctccaaagacagttgtgcctttgtccgagct
ctggagagtggacaaacggaggaggagtgcagacgtcttttcagactggcttcagagaaa
caccagaacctttatcggatggccatgaccggagctgggatagacagacacctcttctgc
ctctatgtcgtctctaaatacttaggagtagattcgccttttttgcacaaggttctgtca
gaaccttggcgcctctccaccagtcagaccccggtccagcagctggagctgtttgatctg
aagaacaacccagactacatttcacttggaggaggatttggacctgttgcagatgatggt
tatggggtttcatacatcattgtcggagaggacctcataaacttccatgtgtcatcaaag
cactcctgcagtgagactgactcccacaggtttggagctcagatccaaaaggcctttcag
gacataatggctctgctgtcagctgatgctaaaagctcctcctcctccaaaggctccaac
caaccgcagtccaagaagctcctgtaa

KEGG   Poecilia reticulata (guppy): 103481241
Entry
103481241         CDS       T05149                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00071  Fatty acid degradation
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103481241
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103481241
   03320 PPAR signaling pathway
    103481241
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103481241
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103481241
SSDB
Motif
Pfam: Carn_acyltransf CPT_N DUF3852 SpmSyn_N
Other DBs
NCBI-GeneID: 103481241
NCBI-ProteinID: XP_008434820
UniProt: A0A3P9QE15
LinkDB
Position
LG19
AA seq 783 aa
MAEAHQAVAFQFTVTPDGIDXRLSHQALSEIYLSGVRSWKKRIIRVKNRVISGVYPASPS
SWLFVVIAILATMYTRSDPSMGLIAKIQEHLPVSQISTQCQAVVSAVVFSTMLWLLLIFT
MRLCLKQLLSYHRWMFEQHGKMSTTTKXWVALVRIFSGRKPLLYSYQGSLPNLPVPAVKD
TVKRYLESVRPLVDDAEYERTNKLASEFESSLGKRLQWYLKLKALWASNYVSDWWEEYVY
LRGRSPIMVNSNYYGMDFQYVTPTPIQAARAGNTIHAFFLYRRKLNKEEIKPSRVPGTVI
PLCSAQCERIYNTTRIPGEETDSVQHWEDSDYIAVYHKGRYFRLRVYQAGRILSPREIEF
QIQRILDDPTLPAKGEAKLGALTAGERIAWAKARREYFSSGVNKRSLDCIERAAFFVALD
DDERGMMADNSPEGLDRYAKSLLHGNCYDRWFDKSFTVVYYKNGKSGINAEHSWADAPVV
AHVWEYVLAADSFQLGYNEEGHCKGAVDSSLPPPQKLGWEIPSECQEQISRSLAVAQALA
DDVDFHVFSFREFGKGKIKKCRVSPDAFVQMALQLAYFRDRGTFCLTYEASMTRLFREGR
TETVRSCSSESSAFVRALEGGEPADVCRRLFRAASEKHQQLYRMAMTGAGIDRHLFCLYV
VSKYLGVDSPFLKEVLSEPWRLSTSQTPVQQAELFDLVNYPEYISCGGGFGPVADDGYGV
SYMFLADNMINFHISCKHSCSDTDAHVFGSKIRAAMHDLLHLLDPVYKEPNKEPSNAEVK
KDK
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggcggaggcccaccaggctgtggccttccagttcaccgtcactccagacggcatcgac
mtgcggctgtcccaccaggcgctctctgagatctacctctccggggttcgctcatggaar
aagcgcatcatccgagtcaagaacagagtgatctcaggtgtgtatcctgccagtccttct
tcttggctgtttgtggtgatcgccatcctggccaccatgtacacgcgctccgacccrtcc
atgggactcatagccaagatacaggagcacctgcctgtcagccagataagtacgcagtgc
caagcggtggtgtcggcggtggtcttcagcacgatgctgtggctgctgctcatcttcacc
atgcggctctgcctcaagcagctgctctcctaccaccgctggatgttcgagcagcacggc
aagatgtccaccaccaccaaartctgggtggctctggtgcggatcttctctggcaggaag
ccgctgctctacagctaccagggatcgctgccaaacctgcctgttcctgccgtgaaggac
acagtcaagaggtatcttgaatcagtgcgccccctggtggacgatgcagagtacgagcgc
acaaacaagctggcctctgagttcgagagcagcctgggtaaacgcctgcagtggtacctc
aaactcaaagcgctctgggcctcaaactacgttagtgactggtgggaggaatacgtctat
ctacgaggacggagccccatcatggtcaacagtaactactatggaatggacttccagtat
gtgactcctactcccatccaggcagccagagccgggaacaccatccacgccttcttcctg
taccgcaggaaactcaacaaagaggagattaaacctagtcgcgtccccggcaccgtcatt
cctctgtgctcagctcagtgtgagaggatttacaacaccacacgaattcccggggaggag
acggattctgttcagcactgggaggacagcgactacatcgcggtttaccacaaaggtcga
tacttccgcctccgggtctaccaggccggcaggatcctgtcgccccgggagatcgagttc
cagattcagcggatcctcgacgacccgacgctgccggccaaaggagaggccaaactcgga
gctcttacggccggggaaagaatcgcctgggcgaaagccaggcgggagtatttcagcagc
ggcgtcaataaacgctctctcgactgcatcgagagggcggccttctttgtggcgctggat
gatgacgagcgaggcatgatggccgacaattcgccagaaggtctggaccgctacgccaag
tccttgttgcacggaaactgttacgacaggtggttcgataaatcctttacagtcgtttac
tacaagaatgggaagagcgggatcaacgcggagcactcgtgggcggacgcgccggtggtc
gcccatgtgtgggagtacgttctcgctgccgacagcttccagctcggctacaacgaagag
ggacactgcaagggagcggtcgactcgtcgctgcctccaccgcagaaactcggctgggaa
attccctcagagtgccaggagcagatctcccgctctctggcggtcgcccaggctctggct
gacgacgtcgacttccatgttttctccttccgagaattcggcaaaggaaagatcaagaag
tgccgcgtcagtcctgatgcttttgtacagatggctcttcagctggcttacttcagggat
cgagggacgttctgtttgacgtacgaagcgtccatgacccgcctgttccgggagggcagg
acggagacggttcgctcctgctccagcgagagcagcgccttcgttcgagcgctagaaggc
ggagagccagcagacgtgtgccggcgtttgttccgcgccgcatcggaaaaacaccaacag
ctgtaccgaatggcgatgaccggcgccgggatcgaccggcacctgttctgcctctacgtg
gtttccaaatacctgggagtggactctcccttcttgaaagaggttctgtctgagccgtgg
aggctgtcgacgagtcagactcccgtccagcaggcggagctgttcgacttggtcaactac
ccagagtacatctcctgtggaggcggctttggacccgtggccgatgatggttatggagtt
tcttacatgtttttggcagacaacatgattaatttccacatctcatgtaaacactcgtgt
tctgacactgacgcccatgtcttcggcagtaagatcagggcagccatgcacgatctgctc
cacctgctggaccccgtctacaaggagcccaacaaggagccgagcaacgccgaggtcaag
aaagacaagtag

DBGET integrated database retrieval system