KEGG   Poecilia reticulata (guppy): 103466187Help
Entry
103466187         CDS       T05149                                 

Gene name
acsl1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103466187 (acsl1)
   00071 Fatty acid degradation
    103466187 (acsl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103466187 (acsl1)
  09143 Cell growth and death
   04216 Ferroptosis
    103466187 (acsl1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103466187 (acsl1)
   03320 PPAR signaling pathway
    103466187 (acsl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pret01004]
    103466187 (acsl1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103466187 (acsl1)
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103466187 (acsl1)
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103466187 (acsl1)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103466187 (acsl1)
  Exosomal proteins of breast cancer cells
   103466187 (acsl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 103466187
NCBI-ProteinID: XP_008409835
UniProt: A0A3P9NDJ9
LinkDB All DBs
Position
LG1
AA seq 698 aa AA seqDB search
MQAQEVLRQLRIPELDDFRQYVRGFPTNALMGMGAFAAITTYWFASRPKALKPPCDLTLQ
SLEIPGGDRARRSVLNDGDGEYMTHYYSDAQTIYEVFMRGLRVSNNGPCLGSRKPNQPYE
WLSYQEVVDRAQRIGSALLHRGHFHTGDKYVGIFSQNRPEWTISELACYTYSLVAVPLYD
TLGTEAIGYIIEKATISTVICDVAEKARMILDCISGQGKTVKTIVLMEAFDKELVSRAAQ
SGVEILSLKEFEAIGEANLQRPTPPKPNDLAIICFTSGTTGNPKGAMLTHGNVISNTAAF
IKVTQDTLKPSTKDVLISFLPLAHMFERVVEGVILIHGARIGYFQGDIRLLMDDLKTLQP
TVFPVVPRLLNRMFDKVFSQANTPLKRWLLDFAFRRKESELKNGVMRKDSMWDKLIFKKV
QMSLGGRVRLMITGAAPVSPTILTFLRAALGCQFYEGYGQTECTAGCTMSMPGDWSAGHV
GPPLPCNAVKLVDVAEMNYLAANGEGEVCVKGPNVFKGYLKDPERTAEAIDKDGWLHTGD
IGKWLPNGILKIIDRKKHIFKLAQGEYIAPEKIETIYNRSDPVAQIFVHGDSLKACLVGI
VVPDPDFLPIWAKKKGFEGSYLELCRNKDVKAAILEDILILGKEGGLKSFEQVRDIALHP
EMFSVQNGLLTPTLKAKRNELRSHFREQIDELYAKIKM
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctcaggaagtcctcagacagctgcggattcccgagctggatgactttcgacag
tatgtccggggctttcctacgaacgccctcatgggtatgggcgccttcgccgccatcacc
acctactggtttgcctccagaccgaaagctctcaagccaccgtgcgaccttacactgcag
tcactggaaatacctggaggagatcgtgccagaaggtcagtgctgaatgacggcgacgga
gagtacatgacacactattacagcgacgcacagacaatatatgaggtgttcatgcgagga
ctcagggtgtcaaataacgggccttgccttgggtcgaggaagccaaaccaaccgtacgag
tggctgtcttatcaagaggtggtggacagagcacagcgcatcggttctgcccttcttcac
agaggtcactttcacacaggcgacaagtacgtcggcatcttttcacaaaacagacccgag
tggaccatttcagagttggcctgttacacgtacagcttggttgcagtcccgctgtacgac
acgctcggcacagaggccattggctacattattgagaaagccaccatttcaacagtgata
tgtgacgtagcagaaaaggctcggatgattctggactgcatcagcggccagggaaagacc
gtgaagaccattgttctcatggaagctttcgacaaggagctggtgagccgagcggcgcag
agcggggttgagattctcagtctgaaggagtttgaggccatcggtgaagctaatcttcag
agaccaacgcctcccaaaccaaatgacctggcaatcatctgctttacatctggaactaca
ggaaaccctaaaggcgcaatgcttactcatggaaatgtaatctccaacaccgcagcgttc
attaaagtaacacaggacacactgaagcccagtaccaaagatgtgctcatctccttcctc
cctctggcccacatgtttgagagggtggtggagggcgtcatcctcatccacggggcacgg
atcggctacttccaaggcgacattcgactgctaatggacgatctgaaaactctgcagcca
acggttttccccgtcgtgccgcgtctcctcaaccgcatgtttgacaaggtgttcagccag
gccaacacacccctgaagagatggctgctggatttcgccttcagaaggaaggagtctgag
ctgaaaaacggggtgatgagaaaggacagcatgtgggacaaactcatcttcaaaaaagtg
cagatgagcctgggcggtagagtcagactcatgatcaccggagcggcccccgtctctcca
accatcctgactttcctacgagccgctctcggctgccagttctacgaaggctacggccag
accgaatgcacggctgggtgcaccatgtccatgcctggagactggtcagcaggtcacgtt
gggcctcctctgccatgcaatgcggtaaaactagtggatgtggcggaaatgaattacctg
gcagcaaacggagaaggagaggtgtgtgtcaaaggaccaaacgtattcaagggatacttg
aaagatcctgagagaacagcagaggcaatcgacaaggatggatggctgcacacaggcgac
attgggaaatggcttccaaatggcattctgaagatcattgacagaaagaaacacattttc
aagctggcacaaggagagtacatcgccccggagaaaatagagaccatctataaccgcagc
gatccagtggctcagatatttgttcatggggatagcttaaaggcgtgcctcgtgggcata
gtggtaccggatccagactttttacctatttgggccaagaaaaaaggatttgaaggatcc
tacctggagctgtgcaggaacaaggatgtaaaggcagccattctagaggacattttgatt
ttgggcaaagaaggcggactaaagtcttttgaacaggtgagagacatcgcattacatccc
gagatgttttctgttcaaaacggtctgctgacccccaccctgaaggccaagaggaacgag
ctccggagtcacttcagagagcagattgacgaactttatgccaaaatcaaaatgtga

DBGET integrated database retrieval system