KEGG   Poecilia reticulata (guppy): 103466187
Entry
103466187         CDS       T05149                                 

Gene name
acsl1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103466187 (acsl1)
   00071 Fatty acid degradation
    103466187 (acsl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103466187 (acsl1)
  09143 Cell growth and death
   04216 Ferroptosis
    103466187 (acsl1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103466187 (acsl1)
   03320 PPAR signaling pathway
    103466187 (acsl1)
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103466187 (acsl1)
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103466187 (acsl1)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103466187 (acsl1)
  Exosomal proteins of breast cancer cells
   103466187 (acsl1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 103466187
NCBI-ProteinID: XP_008409835
UniProt: A0A3P9NDJ9
LinkDB
Position
LG1
AA seq 698 aa
MQAQEVLRQLRIPELDDFRQYVRGFPTNALMGMGAFAAITTYWFASRPKALKPPCDLTLQ
SLEIPGGDRARRSVLNDGDGEYMTHYYSDAQTIYEVFMRGLRVSNNGPCLGSRKPNQPYE
WLSYQEVVDRAQRIGSALLHRGHFHTGDKYVGIFSQNRPEWTISELACYTYSLVAVPLYD
TLGTEAIGYIIEKATISTVICDVAEKARMILDCISGQGKTVKTIVLMEAFDKELVSRAAQ
SGVEILSLKEFEAIGEANLQRPTPPKPNDLAIICFTSGTTGNPKGAMLTHGNVISNTAAF
IKVTQDTLKPSTKDVLISFLPLAHMFERVVEGVILIHGARIGYFQGDIRLLMDDLKTLQP
TVFPVVPRLLNRMFDKVFSQANTPLKRWLLDFAFRRKESELKNGVMRKDSMWDKLIFKKV
QMSLGGRVRLMITGAAPVSPTILTFLRAALGCQFYEGYGQTECTAGCTMSMPGDWSAGHV
GPPLPCNAVKLVDVAEMNYLAANGEGEVCVKGPNVFKGYLKDPERTAEAIDKDGWLHTGD
IGKWLPNGILKIIDRKKHIFKLAQGEYIAPEKIETIYNRSDPVAQIFVHGDSLKACLVGI
VVPDPDFLPIWAKKKGFEGSYLELCRNKDVKAAILEDILILGKEGGLKSFEQVRDIALHP
EMFSVQNGLLTPTLKAKRNELRSHFREQIDELYAKIKM
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgcaggctcaggaagtcctcagacagctgcggattcccgagctggatgactttcgacag
tatgtccggggctttcctacgaacgccctcatgggtatgggcgccttcgccgccatcacc
acctactggtttgcctccagaccgaaagctctcaagccaccgtgcgaccttacactgcag
tcactggaaatacctggaggagatcgtgccagaaggtcagtgctgaatgacggcgacgga
gagtacatgacacactattacagcgacgcacagacaatatatgaggtgttcatgcgagga
ctcagggtgtcaaataacgggccttgccttgggtcgaggaagccaaaccaaccgtacgag
tggctgtcttatcaagaggtggtggacagagcacagcgcatcggttctgcccttcttcac
agaggtcactttcacacaggcgacaagtacgtcggcatcttttcacaaaacagacccgag
tggaccatttcagagttggcctgttacacgtacagcttggttgcagtcccgctgtacgac
acgctcggcacagaggccattggctacattattgagaaagccaccatttcaacagtgata
tgtgacgtagcagaaaaggctcggatgattctggactgcatcagcggccagggaaagacc
gtgaagaccattgttctcatggaagctttcgacaaggagctggtgagccgagcggcgcag
agcggggttgagattctcagtctgaaggagtttgaggccatcggtgaagctaatcttcag
agaccaacgcctcccaaaccaaatgacctggcaatcatctgctttacatctggaactaca
ggaaaccctaaaggcgcaatgcttactcatggaaatgtaatctccaacaccgcagcgttc
attaaagtaacacaggacacactgaagcccagtaccaaagatgtgctcatctccttcctc
cctctggcccacatgtttgagagggtggtggagggcgtcatcctcatccacggggcacgg
atcggctacttccaaggcgacattcgactgctaatggacgatctgaaaactctgcagcca
acggttttccccgtcgtgccgcgtctcctcaaccgcatgtttgacaaggtgttcagccag
gccaacacacccctgaagagatggctgctggatttcgccttcagaaggaaggagtctgag
ctgaaaaacggggtgatgagaaaggacagcatgtgggacaaactcatcttcaaaaaagtg
cagatgagcctgggcggtagagtcagactcatgatcaccggagcggcccccgtctctcca
accatcctgactttcctacgagccgctctcggctgccagttctacgaaggctacggccag
accgaatgcacggctgggtgcaccatgtccatgcctggagactggtcagcaggtcacgtt
gggcctcctctgccatgcaatgcggtaaaactagtggatgtggcggaaatgaattacctg
gcagcaaacggagaaggagaggtgtgtgtcaaaggaccaaacgtattcaagggatacttg
aaagatcctgagagaacagcagaggcaatcgacaaggatggatggctgcacacaggcgac
attgggaaatggcttccaaatggcattctgaagatcattgacagaaagaaacacattttc
aagctggcacaaggagagtacatcgccccggagaaaatagagaccatctataaccgcagc
gatccagtggctcagatatttgttcatggggatagcttaaaggcgtgcctcgtgggcata
gtggtaccggatccagactttttacctatttgggccaagaaaaaaggatttgaaggatcc
tacctggagctgtgcaggaacaaggatgtaaaggcagccattctagaggacattttgatt
ttgggcaaagaaggcggactaaagtcttttgaacaggtgagagacatcgcattacatccc
gagatgttttctgttcaaaacggtctgctgacccccaccctgaaggccaagaggaacgag
ctccggagtcacttcagagagcagattgacgaactttatgccaaaatcaaaatgtga

KEGG   Poecilia reticulata (guppy): 103468238
Entry
103468238         CDS       T05149                                 

Gene name
acsbg2
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2 isoform X1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103468238 (acsbg2)
   00071 Fatty acid degradation
    103468238 (acsbg2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103468238 (acsbg2)
   03320 PPAR signaling pathway
    103468238 (acsbg2)
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103468238 (acsbg2)
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103468238 (acsbg2)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 103468238
NCBI-ProteinID: XP_008413375
UniProt: A0A3P9NTW7
LinkDB
Position
LG8
AA seq 798 aa
MGVLSWSCKSDSWLQQLSEQQSSFHFPAVNVTDRRLSKXSSGVTACESSAMSEPVVVEPP
KAGEALQSCGAGDSSASLDDGIGDTANESSEEESTGEKEEEVAAGDAAAAAALQISDTPQ
VNAQRPDSLSVPPSSELRLWTTQRDGEVKLRVEGSGEAADALTVNQMFAAAADRFSDFTA
LKWREGEQQKCLTYKQYYQDCRTAAKSFLKLGLERFHGVGILGFNSAEWFIADIGAILAG
GLAVGIYTTNSPEACHYVAENSKTNIIVVENHKQLQKILQIEDKLPHLKAIIQYKDALKE
KRPNLYSWAEFMELGRNDPDGPLDAIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITW
TAAATGLHVELKDSLQFQERVVSYLPLSHIAAQMVDIWITMKVGGLTYFAQPDALKGSLV
NTMKETRPTAFMGVPRVWEKMQEKMKSVGAKSSTVQRKVAAWAKDVGLQTNLTKMNQSVA
AARTPFSYQVAKKLVFKKVRKALGLDRCTKCFTGAAPITKDTLEFFLSLNIPLYELYGMS
ESTGPHTISTPEAFKLTSCGKEISGCKTRLHSPDNEGNGEICFWGRHVFMGYLDMPDKTQ
EAIDEDGWLHSGDLGKHDENGFLFITGRIKEMIITAGGENVPPIPIEDAVKEAVPLISNA
MLIGDKRKFLTMLLTIKCQVNAETGDPEDELTPEAVELCRKLGSNATRVSDIAGGRDRAV
HTAIQEGINRVNENATSNAQRIQKWIILERDFSVGGGELGPTMKLKRPVVLKMYREQIDN
FYKETPTPTTQENPLPPK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgggagtgttatcttggagttgtaaaagtgacagctggctccagcagctcagcgagcag
cagagctcctttcatttccctgcwgtcaacgtcacagatagacgtctttcaaaarcttct
tctggcgtgaccgcgtgcgagtccagcgccatgtccgaacccgtggtggtggagcctcct
aaagcaggagaagcactgcagtcctgtggtgcaggagacagctcagcctcccttgatgac
ggcattggagacacagcaaatgagtcatcagaggaagagtccaccggggagaaggaggag
gaggtcgctgctggagatgcagccgccgccgccgctctgcagatctcagacacaccacag
gtgaacgcccagcgcccggactccctgtctgtgccgccatcatcagagctccgtctctgg
acgacgcagcgcgatggagaggtgaaactccgggtcgagggctccggtgaggctgcagat
gctctgactgtgaaccagatgtttgctgcagctgcagatcgattcagtgacttcacagct
ttgaaatggagagagggcgagcaacagaaatgcctcacctacaaacaatactaccaggac
tgccgcactgctgccaagagcttcctaaagctcggtttggagcgtttccatggcgtcggg
attctgggcttcaactctgccgagtggttcatcgccgacatcggcgccattttggccggg
gggctcgctgtggggatttacaccaccaactctcctgaggcttgtcactacgtagcagaa
aactccaaaacaaacattatcgtggtggagaaccataaacagctgcagaaaatcctccag
attgaagacaagctgcctcacttgaaagcaattatccagtacaaagatgcactaaaagag
aagaggcccaacctgtactcgtgggcagaattcatggagctcggccgcaacgatccggac
gggcctcttgatgcaatcatctccagccagaagcccaaccagtgctgcacgctcatctac
acctcaggaaccacgggtcagccgaagggcgtgatgctgagccatgacaacataacttgg
acagcagctgcaacaggtttacacgtcgagctgaaggacagccttcagttccaggagagg
gtggtcagctacctgccgctgagccacatcgcggctcagatggtcgacatctggatcacc
atgaaggtcggagggctgacctacttcgctcagccggacgccctgaagggatctctggtg
aacaccatgaaggaaacgcgtccgacggccttcatgggcgtcccgcgtgtctgggaaaag
atgcaggagaaaatgaaatccgtcggagcgaaatcatcaactgtgcagaggaaagtggct
gcctgggccaaagatgttggtctgcagaccaatctgaccaaaatgaatcaaagcgtagca
gctgcccgcaccccgttcagctatcaggttgccaaaaagctcgtgtttaagaaagtacgc
aaggctctcggcctggaccgctgcaccaaatgcttcacaggtgccgccccaatcaccaaa
gacaccctggagttcttcctcagcctcaacattcctctctacgagctttacggcatgagc
gagagcaccggaccccacaccatctccacacctgaggccttcaaactcaccagttgtggt
aaagagatctcaggatgtaaaacaaggctgcacagccccgacaatgagggaaacggtgag
atctgcttctggggccgccatgtcttcatgggttacctcgacatgcccgacaagacgcag
gaagccatcgacgaagacggctggctgcactcgggcgacctgggaaaacacgacgagaac
gggttcctcttcatcactggtcgtatcaaagagatgatcatcacagcgggaggcgaaaac
gtccctccgatccccatcgaggacgcagtgaaggaggccgtgccgctgataagcaacgcc
atgttgataggagacaagaggaagtttctcaccatgctgctcactattaagtgccaagtg
aacgccgagaccggcgaccccgaggacgagctgacgcctgaagccgtggagctctgcagg
aagctgggcagcaacgccacgcgcgtctccgacatcgcgggcggccgggaccgcgccgtc
cacaccgccatccaggagggaatcaaccgtgtcaacgagaacgccacgtccaacgcgcag
cgcatccagaagtggatcattctggagcgggacttctcagtcggcggaggagagctgggt
ccgaccatgaagctgaagcgacccgtggtgctgaagatgtacagagagcagatcgacaac
ttctacaaagagacgccgaccccgacgacccaggagaacccgctgcctcccaagtag

KEGG   Poecilia reticulata (guppy): 103469930
Entry
103469930         CDS       T05149                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2-like
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103469930
   00071 Fatty acid degradation
    103469930
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103469930
   03320 PPAR signaling pathway
    103469930
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103469930
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103469930
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 103469930
NCBI-ProteinID: XP_008416227
UniProt: A0A3P9NQD1
LinkDB
Position
LG9
AA seq 699 aa
MLKGKTDVSPAASKTSTDPPAKLPRTFDQDNNPTKSPKERKKSVTLMSAELATMLTPSER
LFTSERNQAVRLRMESTGPGSETPITIHQMFLEAVESYGDHPALVFRKGSRMMTLTWRQY
YEQCRAAAKSFLKLGLERYHGVGILGFNSPEWFISDVAGILAGGLAVGIYTTNSAEACHY
VASNCEANILVVENQQQLEKILKIKSQLPHLKAIVQYEGELEQKAEFLYTWDQFMKLGEN
IPNKQLNAVIDSLRANECCTLIYTSGTTGNPKGVMLSHDNITWTAHAVSKMINLHSCEEV
LVSYLPLSHIAAQMMDIWCSMSLIATAHFAEPDALKGSLVNTLKEARPTGFLGVPRVWEK
IQESMKAVGAKSSALRKRVADWAKAIGLQYSYSVMNGENEVPWGFMLANNLVFKRVRYEL
GLDRCRLCCSGAAPMTKETLDYFMSLSIPVKELYGMSESSGPHAVSIHEYRIGSVGKVMA
GCKTKLDKPDADGNGEICYWGRHVFMGYLNMPDKTAEALDEQGWLHSGDLGKHDEDNFLY
ITGRIKEIIITAGGENIPPVPIEDAVKYELPIISNAMVIGDKQKFLSMLLTLKCVMDDEG
NPTDMLSPVAVDICQQLNVRATKVSEIIESKEPALYKAIQDGINRFNKTSTSNAQKIQKW
ILLEKDFSVNGGELGPTLKLRRPVVAKMYQSQINKLYSR
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgctaaagggaaaaactgatgtttcacctgcagcatcaaagacgagcaccgatcctcct
gccaaacttccaagaaccttcgatcaggacaacaatccaacaaaatctcctaaagagcgg
aaaaagtcggttaccttgatgtcggcggaattggcgaccatgttgaccccctctgagagg
ctgtttacctccgagagaaaccaggcggtcaggctgaggatggagagcacgggtccgggc
tcggagactcccatcaccattcatcagatgttcctggaggcggtggagagctacggtgat
cacccggctttggttttcaggaaaggtagccggatgatgactctgacctggaggcagtac
tacgaacaatgtcgtgcagcggccaagagcttcctcaagctcgggttggagcgttaccac
ggagtcggcattctgggattcaactctcccgagtggttcatctcggacgtcgccggcatc
ttagcagggggtctggctgttggtatttacacgaccaactctgcggaggcctgtcattac
gtagcctctaactgtgaggcaaacattctggtagtggagaaccagcagcagctggaaaag
atcctgaagattaaaagtcagttgcctcatctgaaagctatcgtccagtatgaaggcgaa
ctggagcagaaagcagagttcctctacacatgggaccagtttatgaaacttggagagaac
attcccaacaagcagctgaacgctgtgatcgacagtctgcgggccaacgagtgctgcacg
ctcatctacacctccggcaccaccggaaatcccaaaggcgtcatgctgagccacgacaat
atcacatggacggcccacgccgtgtccaagatgattaacctacactcctgcgaggaagtg
ctggtcagttacctgccgctcagccacattgcagcacagatgatggacatttggtgctcc
atgagtctcatagccaccgcccattttgcagagccggacgccctgaagggatctttggtg
aacacgctgaaagaggctcgtccgaccggcttcttgggcgttcctcgggtttgggagaag
atccaggagagcatgaaagctgtgggcgccaagagctctgccctgaggaagagggtggcg
gactgggccaaggccatcggcctgcagtacagctacagcgtcatgaacggggagaacgag
gtgccgtggggcttcatgctggccaacaatctggtgtttaagagggtccggtacgagctg
ggtttggaccgctgcaggctgtgctgcagtggagccgctcccatgaccaaagaaactctg
gactacttcatgagcctgagcatcccggtgaaggagctgtacggcatgagtgagagctcc
ggcccacacgccgtctccatccacgagtatcgcattggaagcgttgggaaggtgatggcg
ggctgcaaaacgaagctggataagccggacgcggacgggaacggagaaatctgctactgg
ggccggcacgtcttcatgggctacctgaacatgccggacaaaacggccgaggcgctggac
gagcagggctggctgcactctggagacttgggcaaacacgacgaggacaacttcctgtac
atcacaggcagaataaaagagatcatcatcaccgccggtggcgagaacatcccccccgtg
cccatcgaggacgccgtgaagtacgagcttcccatcatcagcaacgccatggtgatcgga
gacaagcagaagttcctctccatgctgctcacgctcaaatgcgtaatggacgacgagggc
aaccccaccgacatgctgagccccgtggcggtggacatctgtcagcagctcaacgtcagg
gccaccaaggtgtcagagatcatagagagtaaggagccggcgctgtacaaagccattcag
gacggcatcaaccgattcaacaaaacatccacgtccaacgctcagaagatccagaagtgg
atcttactggagaaagatttctccgtcaacggaggagaattgggacccaccctgaaactg
agacggcccgttgtggcaaaaatgtaccagagccaaattaacaaattgtactctcgctga

KEGG   Poecilia reticulata (guppy): 103470507
Entry
103470507         CDS       T05149                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103470507
   00071 Fatty acid degradation
    103470507
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103470507
  09143 Cell growth and death
   04216 Ferroptosis
    103470507
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103470507
   03320 PPAR signaling pathway
    103470507
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103470507
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103470507
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103470507
  Exosomal proteins of breast cancer cells
   103470507
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 103470507
NCBI-ProteinID: XP_008417224
UniProt: A0A3P9NJ84
LinkDB
Position
LG9
AA seq 699 aa
MQLQEWLRSLCSHAGLKGSEAEELWSLLPSLSTSSLLGLGALASLTVYWLMTRPRPVRPP
CDLQAQSVAVGGDPSCRRSALLKDDNLLEFYYDDIRTVYEMFQRGLRISGDGPCLGHRKP
GQPYEWISYSEVAQQAQWMGSGMIAKGCQQFVGVYSPNRPEWVISEMACYTYSMALVPLY
DTLGTEAMVHILNLAEMSLVVCDREERAALLLECKEKGTTPKVSCLVLFNDFSQAFWERA
KKCEVDVLNREQLMELGKQNLKDPVLPQPQDLAVVCFTSGTTGKPKGAMITHGNIASNTS
SVIKILEGSFVIRQEDVSISYLPLAHMFERMIQLTMYCYGARVGFFQGDVSLLMDDIKTL
KPTLFPVVPRILNRIYDKILGSVTSPFQRALLHYAVRRKQAELCRGIVRNDSLWDKLVFK
KIQASLGGNLRFALTASAPISCTVLSFLRATMGCMICEGYGQTECTGGCTFSLIGDSSTG
HVGAPLPCAMVKVVDIPDMNYFAKNGEGEICIRGPSVFKGYLKDPERTAEALDSDGWLHT
GDVGQWLPNGTLRIIDRKKHIFKLCQGEYVAPEKIENVYMRSVPVLQVFVHGDSLQSYVV
GIVVPDREVFVEWAKERAFVGSYQELCQNPDVKNAVLEDMRAVGKEAGLKSFEQVKDLYL
HPEMFSIANGLLTPTLKSRRADIRRVFQEQLANMYKTPI
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgcagctccaggagtggttgcgttcgctttgctcccacgcaggactcaaaggctccgaa
gcggaggagctgtggagtctcctgccgtccctgtcgacctcctctctgctggggctgggg
gccctggcgtccctcaccgtgtactggctgatgacccggccccggcccgttcgtcctccc
tgtgatctgcaagcccagtctgtagctgtcggcggagaccccagctgcaggagatctgct
ctccttaaagatgacaatctgctggagttttactacgatgacatcaggacggtgtatgag
atgttccagagaggtctgaggatatcaggagacggtccgtgtctcggccacaggaagccg
ggccagccctacgagtggatctcctactccgaggtggctcagcaggctcagtggatgggg
agtgggatgattgccaaaggttgccagcagtttgttggggtttactctccaaacaggcca
gagtgggtcatctcagagatggcctgctacacctactccatggctctggttccgctgtac
gacacgctggggacggaggccatggtccacatcctcaaccttgctgagatgtccctggtt
gtctgtgaccgagaggagagggcagcgttgttgctggagtgcaaagagaaaggcacaact
cccaaagtctcctgtcttgttctgttcaacgacttcagccaagccttttgggagagggcg
aagaagtgcgaggtggacgtcctgaaccgggagcagctcatggagctgggaaagcagaac
ctcaaagatcctgtgctgccccagcctcaggatctggccgtggtttgcttcaccagtgga
accacagggaagcccaagggagccatgatcacccacgggaacatcgcctccaatacttcc
tctgtcattaagatcctggagggttcgtttgtgatccgtcaagaggatgtgtcgatctct
tacctgcctcttgcccacatgttcgagaggatgatccagctcacaatgtactgctacgga
gcccgagtggggttcttccagggtgacgtttctcttctcatggacgacattaagactctc
aaaccgaccctcttccccgttgtgccccgcattcttaatcgcatctacgacaagatcctg
ggttcggtgacctctccgtttcagcgggctctgctccactacgctgtcaggagaaagcag
gccgagctctgtagagggattgtgcgcaacgacagtctgtgggataaactggtgttcaag
aaaattcaggccagtttaggaggtaatctccggtttgccttgactgcctcagcacccatc
tcctgcacggtgttgtccttcctcagagccactatgggctgcatgatatgtgagggttac
ggacagacagagtgcactggaggctgcactttctctttaataggagactccagcacaggt
catgttggagcgcctttgccatgcgctatggtgaaggtggtggacatccctgatatgaac
tactttgctaagaatggagaaggagagatctgcatccgcggccccagtgtgttcaagggt
tatctgaaggacccggagaggacagcggaggccttggacagcgacggctggctccacact
ggggatgtgggccagtggcttccaaacggcacgctgcgcatcatcgacagaaagaagcac
atcttcaagctgtgccagggagagtacgtcgctccagagaagatagagaacgtctacatg
cgttctgttcccgtcctccaggtgtttgtgcatggagacagtttgcagtcctatgtcgta
ggtatagttgttcctgacagagaagtgtttgttgaatgggctaaggagcgggcctttgtg
gggtcctaccaggaactgtgtcaaaatccagatgtaaagaacgcagtattagaagacatg
agggctgtggggaaagaagcagggctcaagtcctttgaacaggtgaaggatctttattta
catccggagatgtttagcatcgccaacggacttctcacgcccaccctaaagagcaggcgc
gccgacatccgcagggtgtttcaagaacagctagcgaacatgtacaagactccgatttaa

KEGG   Poecilia reticulata (guppy): 103470977
Entry
103470977         CDS       T05149                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103470977
   00071 Fatty acid degradation
    103470977
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103470977
  09143 Cell growth and death
   04216 Ferroptosis
    103470977
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103470977
   03320 PPAR signaling pathway
    103470977
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103470977
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103470977
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103470977
  Exosomal proteins of breast cancer cells
   103470977
SSDB
Motif
Pfam: AMP-binding Mak10
Other DBs
NCBI-GeneID: 103470977
NCBI-ProteinID: XP_008417944
LinkDB
Position
LG10
AA seq 454 aa
IAIFCETRAEWMITAQACFRHNFPLVTFYATLGEDAIAHGLNETGVTHLVTSMELLESKL
KKVLPQISKLKHIIYVDEKKVNTEGYPEGLSIHSMKAVLDLGVLPENAKREIVTPQPSDL
AVVMYTSGSTGRPKGVMIVHSNLIAGMTGQCERIPGLGPDDTYIAYLPLAHVLEMTAEIS
CVTYGCRIGYSSPQTLSDQSTRIKKGSKGDCSVLKPTLMAAVPEIMDRINKNVMSKVQEM
SYLQKTLFTLGYKYKLEQVKRGHDAPLCNKLLFRKVKKLLGGRVRMMLSGGAPLSSATQR
FMNVCFCCPVGQGYGLTETCGAGTITEVADISTGRVGAPLICCEIKLRDWTEGGYTSKDE
PHPRGEILIGGPNVTMGYFGQDGNDQDFFTDENGQRWFCTGDIGEVYPDGCLMIVDRKKD
LVKLQAGEYVSLGKVESALKTCALIDNICAYANR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atcgccattttctgcgaaaccagagcggagtggatgataactgcccaggcatgcttcagg
cacaacttcccattggtgacgttctacgctacgctgggagaagatgcgattgcgcacgga
ctcaacgaaactggagtcactcacttggtcaccagcatggagctgctcgaaagcaaactt
aaaaaagtactaccrcagatctccaaactgaagcacatcatctacgtggacgagaagaag
gtgaacacagaaggctacccagaaggactttccatccacagcatgaaggcggtgctggac
ctgggcgtcctgccggagaatgcgaagagagaaattgtgacgccgcagccctccgatctg
gcygtggtgatgtacaccagcggttccacaggcagacccaaaggggtcatgatagtccac
agcaacctgatcgcagggatgacaggccagtgtgaacgcatccctggacttggacctgat
gatacttacattgcatatctgcccctggctcatgttctggaaatgacggcggaaatctct
tgtgtaacatacggctgccggattggttactcatccccccagactttgtcagatcagtcc
accagaataaagaaaggaagtaaaggagactgctctgtcctcaaacccactctgatggca
gcagtgccggaaatcatggatcgcatcaacaagaatgtaatgagcaaagttcaggaaatg
agctaccttcagaagacactgtttactctgggctacaaatacaaactggagcaggtcaag
aggggccatgacgcacctctctgcaacaagttgctgtttcggaaagtraagaaactactg
ggtgggcgagtcaggatgatgttgtccggcggagctcccctgtcctcggccactcagagg
ttcatgaacgtgtgcttctgttgtccggtgggccagggctacggcctcaccgaaacctgt
ggagccggtaccatcactgaagtcgcagacatcagcaccggccgtgttggagctcctctg
atttgctgcgagatcaagctcagagactggactgaagggggctacaccagcaaagacgag
cctcatccaagaggggaaatcctgattggcggtcccaacgttaccatgggttacttcggg
caagacggcaacgatcaggacttctttacggacgagaacggtcagaggtggttctgcacc
ggagacattggagaggtttacccggatggctgtctgatgattgtagatcgcaaaaaagat
ttggtgaagctgcaggcgggggagtacgtgtctctcggtaaagtggaatctgctctgaaa
acctgcgctctcatcgacaacatctgtgcttacgccaacaggtga

KEGG   Poecilia reticulata (guppy): 103471009
Entry
103471009         CDS       T05149                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1-like isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103471009
   00071 Fatty acid degradation
    103471009
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103471009
  09143 Cell growth and death
   04216 Ferroptosis
    103471009
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103471009
   03320 PPAR signaling pathway
    103471009
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103471009
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103471009
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103471009
  Exosomal proteins of breast cancer cells
   103471009
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 103471009
NCBI-ProteinID: XP_008417987
LinkDB
Position
LG10
AA seq 699 aa
MLSQEFLEKMKALELEDVSQYIRNISTPMLVSMGAVAAATTYYLAMRPKALPPLWDLHTQ
SVEVPGSDFVHHSALQKEDGYMTHIYEDARTMYESFIRGARVSNNGPCLGYRKPKQPYEW
MSYKEVMKRAENLGSAFLHKGHSKTTNPYIGIFSQNRPEWTISELACYTYSLVSVPLYDT
LGTEAISYIIDKASISTIVCDVMDKASLVLHCLADMKHSVKTIVLMETPSTSLVERAQQA
GVHILSLQEMEALGQANYKEPIPPQTNDMAVICFTSGTTGSPKGAMLTHGNIVSNYSSFI
KLTELCCPLNSSDVHISYLPLAHMFERLVQAVMLVHGARIGFFQGDVRRLSDDLIALRPT
VLPVVPRLLNRMYDKIFGQANTSLKRWLLDLAYRRKQAEVEKGIVRTDSIWDRLIFRKVQ
ASLGGRVRLMVTGAAPISPTVLSFLRVAVGCQFFEGYGQTECTAGCAMTLPGDCSAAGHV
GPPLPCNAIKLVDVAEMNYLAVNGEGEVCVKGPNVFQGYLKDPEKTAETIDADGWLHTGD
IGKWLPNGTLKIVDRKKHIFKLAQGEYIAPEKIENIYTRSDAVVQVFVHGDSLQACLVAV
VVPDPDFLCSWAKRTLRLQGSYQELCGKMEVKAAILEDMLRLGKEGGLKSFEQVKAIHIH
TEMFSIENGLLTPTMKAKRNEMRQYFRSQIDELYAGISM
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgctgagccaggagttcctagagaagatgaaggccttggaactggaagacgtgagccag
tacatcaggaacatctccacccccatgttggtcagcatgggagcagtggccgctgccacc
acctactacctggctatgcgacccaaagccctcccaccactctgggacctgcacacgcag
tcagtcgaggttccgggcagtgattttgtgcatcactcagcgcttcagaaagaagacggt
tacatgactcacatctatgaagatgccagaactatgtacgagtccttcatcagaggagca
agagtctccaataacggtccctgtttgggctacaggaaaccaaaacagccttatgagtgg
atgtcttacaaagaggttatgaagcgagcagaaaatctgggttctgcgtttcttcacaaa
ggacattcaaaaaccaccaacccctacattggtattttctctcagaacagaccagagtgg
accatcagtgagctggcctgctacacctactccctggtgtccgtccctctttatgacaca
ctgggaacagaggccatttcttacatcatagacaaagcttccatctctaccatagtgtgt
gacgtgatggacaaggccagcctggtgctgcactgccttgcggacatgaaacactcagtg
aagaccatcgttctgatggagactcccagcaccagcctggtggagagggcccagcaggcc
ggagtccacatcctgagtctgcaggagatggaggctctcggtcaggccaactacaaggaa
ccgattcctcctcagactaatgacatggcggtcatctgcttcaccagtggaacaacagga
agcccgaaaggcgcaatgctaacacatggcaacattgtgtccaactactcttccttcatc
aaactgacagagctgtgctgtccgctgaattccagcgacgtccatatttcctacctaccc
ttggctcatatgtttgaaagattagtccaggcggtcatgctggtgcatggagccagaatc
ggctttttccagggagacgtccgccggttatcggatgatctgatcgcgctgaggcctacg
gtgttaccagtcgtacccagacttctcaacagaatgtatgataagatctttgggcaggcc
aacacgtctttgaagcgctggctgctggatttggcctacaggaggaaacaggcagaggtc
gagaaaggcatcgtgaggacagacagcatctgggatcgactcatcttcaggaaggtccag
gccagcctcggaggccgcgtgcgtctcatggtcacgggagcggcccccatctctcctaca
gtcctctccttcctcagagttgctgttggctgtcagttcttcgaaggctacgggcagacg
gagtgcaccgccggatgtgcgatgacccttcctggcgactgtagtgcagcaggtcatgtc
ggaccgcctctgccctgcaacgccatcaaactggtggatgtcgctgagatgaactacctg
gctgtaaacggggaaggagaggtgtgtgtgaagggtccaaacgtcttccagggctacctg
aaagacccagagaagaccgcagagacaatagatgcagacggatggctgcacacaggagac
attgggaagtggcttcctaacggcactctgaagattgtcgacaggaagaagcacattttc
aagctggcccagggcgagtacatcgctcctgagaagatcgagaacatctacacgaggagt
gatgcagtggtgcaggtgtttgtgcatggagacagtctgcaggcttgtctggtagcagtg
gtggtccctgaccccgacttcctgtgtagctgggccaagaggacgctgaggctgcaggga
agctaccaggagctgtgtgggaaaatggaggtcaaggcagccatcttggaggacatgctg
cggcttggcaaagagggaggcctcaagtcctttgagcaggttaaggccatccacatccat
acagagatgttctccatcgagaacggcctgctcaccccaacaatgaaggctaagaggaac
gaaatgcgccagtacttcaggtcccagatagatgagctgtacgctgggatcagcatgtag

KEGG   Poecilia reticulata (guppy): 103474928
Entry
103474928         CDS       T05149                                 

Gene name
acsl3
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103474928 (acsl3)
   00071 Fatty acid degradation
    103474928 (acsl3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103474928 (acsl3)
  09143 Cell growth and death
   04216 Ferroptosis
    103474928 (acsl3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103474928 (acsl3)
   03320 PPAR signaling pathway
    103474928 (acsl3)
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103474928 (acsl3)
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103474928 (acsl3)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103474928 (acsl3)
  Exosomal proteins of breast cancer cells
   103474928 (acsl3)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 103474928
NCBI-ProteinID: XP_008424429
UniProt: A0A3P9P1Q4
LinkDB
Position
LG13
AA seq 719 aa
MRLKEDLNPMLLLLFHLMVWIYTAITFLPSYLLSWVSRSHENFYGSEEDRAKKPKACSVL
GRSEGPYRAVSATKRLLSSLHPGADTLDKMFEYAAMRFPQRDCLGTREVVTEEDERQSNG
KVFKKVVLGEYRWLSYKEALTAATQLGSGLASLGQRPKTNIAIFCETRAEWLIAAQACFA
YNFPLVTLYSTLGGPAIAHGLNEAQVTHIITSRELLETRLKAILAEVPRLQHIIVVDNTP
TTWPGFPRGISIYNMATVQKLGARPDKATFERKQPLSSDIAVIMYTSGSTGIPKGVMISH
SNIIASITGMAERIPNLSEEDTYIGYLPLAHVLELCAELVCISYGCRIGYSSPQTLADQS
SKIKKGSRGDTSVLKPSLMAAVPEIMDRIYKNVMTKVEEMNSFQRTLFILAYNYKLEQLS
KGYSTPLCDRFVFRKVRSLLGGRTRVLLSGGAPLSAATQRFMNVCLCCPVGQGYGLTETC
GAGTICEHWDYSTGRVGGPLVCCEIKLKDWVEGGYRSTDRPHPRGEILVGGPNITMGYYN
CEAKKQEDFFVDENGQRWFYTGDIGEIHEDGCLKIIDRKKDLVKLQAGEYVSLGKVEAAL
KNCPLVDNICVYANSDETYVIGFVVPNQKQLLALAGQYGIRGSWDELCNSEAMEELVLKV
ITEAALTAQLERFEIPRKIRLSPDPWTPETGLVTDAFKLKRKELKTHYKDDIERMYGGK
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaggctcaaagaggacctgaatcccatgctgctgctcctcttccacctcatggtgtgg
atctacaccgcaatcaccttcctgccttcctacctcctcagctgggtctccagatcccat
gagaatttttacgggtcagaggaggatcgggccaagaaacctaaggcttgttcagttcta
ggacgctcagagggaccctacagagcagtcagtgccaccaaaaggctcctttcatcgcta
caccctggagcagatacgctggataagatgtttgagtacgcagccatgaggttcccgcaa
agagactgtcttgggacgagggaagtggttacagaggaagacgagcgacagagcaacggg
aaagtgttcaagaaggtagtccttggagagtaccgctggctctcctataaagaggctctg
acagcagcgactcaactgggcagcggtttggcatctttgggtcagcggccgaaaaccaac
atcgccatcttttgtgagacccgagcggagtggctgatagctgcccaggcctgctttgcg
tacaacttcccattggtcacactgtactccaccctgggaggtccagccatcgctcatggt
ctgaatgaggctcaagtcacccacattatcaccagcagagagctcctggagaccagactg
aaggcgatcttagctgaagttccaaggctgcaacacatcatcgtagtggacaacacaccg
accacatggcccggctttccccggggcatcagcatctacaacatggccactgttcagaag
ctgggagccagaccagataaagcgacatttgagcgtaagcagcctctgtcttcagacatc
gcagtcatcatgtacaccagtggttcaacaggtattccaaagggcgtcatgatctcccat
agcaacatcatcgccagcatcacagggatggcggaaaggatacccaacctgagtgaagag
gatacctacatcggctacctccctctcgctcatgtgcttgagctgtgtgcagagcttgtc
tgcatttcttatggctgccggattggctattcctcacctcaaacacttgctgaccagtca
tccaagatcaagaaaggaagcaggggagacaccagtgtcctgaagcccagtctgatggca
gctgttccggagattatggatcgcatctacaagaatgtgatgactaaggtggaggagatg
aacagtttccagcgaactctcttcattttagcatataactacaaactggaacagctttcg
aaaggatacagcacaccactgtgtgacaggtttgtgttcaggaaagttcgttctctgctc
gggggtcgaacacgagtcttgttgtcaggcggagctccactttctgccgccacacaacgt
ttcatgaatgtatgtttatgttgcccagtgggtcagggatatggcctgacagagacctgt
ggtgccgggacgatatgcgaacactgggattacagcactggtagagtgggagggccgctg
gtttgctgtgagatcaagctcaaagactgggtggaaggcggttaccgaagtactgacagg
cctcatcccaggggagagattcttgttggtggacctaatatcaccatgggatattacaac
tgcgaggcaaaaaaacaagaggacttttttgtcgatgaaaacggccagcggtggttctac
actggggacatcggagagattcacgaagacggatgtctcaagattatcgatcgtaagaag
gacctggtgaagctgcaggcgggagagtacgtctccctgggaaaggtggaggccgcgctg
aagaactgccctctggttgacaacatctgtgtttatgccaacagtgatgaaacatacgtg
attggctttgtggtgcccaatcagaagcagctgctggctctggctggccagtacggtatc
cgggggtcatgggacgaactgtgcaacagtgaggccatggaggagctggttcttaaggtc
atcactgaggctgcactgacagcccaactggagcgctttgagattcctcgcaagatccgt
ctgagcccagacccctggacgcctgagacgggactggtgaccgatgctttcaagctcaaa
cgcaaggagctgaagacgcattacaaagacgatattgagagaatgtacggtggaaaataa

KEGG   Poecilia reticulata (guppy): 103475331
Entry
103475331         CDS       T05149                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 6 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103475331
   00071 Fatty acid degradation
    103475331
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103475331
  09143 Cell growth and death
   04216 Ferroptosis
    103475331
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103475331
   03320 PPAR signaling pathway
    103475331
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103475331
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103475331
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103475331
  Exosomal proteins of breast cancer cells
   103475331
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 103475331
NCBI-ProteinID: XP_008425098
LinkDB
Position
LG14
AA seq 722 aa
MLAFVLVSGSLWIILELSSTLMEKMQVQEMMSGLRIPEMDELGQFFRSLPTSTLVGIGAL
TAVLAYWFATRPRPIKPPCSLHHQSEEVPHEDGGRRSMMGDPTRLLTHYHDDARTMYEVF
QRGLHISGDGPCLGSRLPNQPYRWLSYKEVSARAEHLGSGLLHQGCQPNPDQFIGVFAQN
RPEWIISELACYTYSMVVVPLYDTLGADAIRFIINTADISTVICDKVEKAQVLLVNVERK
KTPKLRRIILMDAFDSELETRGKACGVHVQALQEVEALGREHYRTPIPPAPDDLSIVCFT
SGTTGNPKGVMLTHGNVVADFAGFLKVTDTVIFPNQDDCLISFLPLAHMFERLIENVVYC
HGGRIGFYQGDIRLLPEDMKALRPTIFPVVPRLLNRMYDKIFSQANTPVKRWLLNFAAKR
KGAEVSRGIIRNDSVWDKIFFSKIQASLGGRLRMIITGAAPTSPSVLSFLRAALGCQVYE
AYGQTECTAGCTYTTPGDWTSGHVGAPLPCNLIKLVDVPEKNYFASKGEGEVCVKGPNVF
KGYLKDPERTAETLDADRWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYISPEKIENI
YIRSEPVAQLYVHGDSLQSCLVGIVVPDPEVMPEWAKKKGIQGTYKDLCKNTELKKAILE
DLVRLGKANGLLSFEQVKNIYIHNEMFSIENGLLTPTLKARRPELKEFFKKKIDDLYSSI
SM
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgctcgcattcgtcctggtctctgggtctctctggattatattagaattgagttccacc
ctaatggagaagatgcaggtccaggaaatgatgagtggcctgaggataccagagatggac
gagctgggccagttctttcgctccctgccgacctccaccttggtgggcatcggcgccctg
acagctgtgttggcgtactggtttgccaccaggcctcgacccatcaaacctccctgtagt
cttcatcaccagtccgaggaagtgccgcatgaagacggaggtcgaagatccatgatgggc
gacccgaccaggctgctcactcattaccatgacgacgccaggaccatgtatgaggtcttt
cagagaggcctgcatatatctggcgatggaccctgcctgggctctcgactcccaaaccag
ccctacagatggctgtcctacaaagaggtttctgcccgggccgagcatctgggctcaggc
cttctgcaccagggctgccaacccaaccccgaccagttcattggggtgtttgcacagaac
agacccgagtggatcatctcagagctggcttgttacacctactccatggtggtggttccc
ctctacgacacgcttggtgcagacgctatacggttcatcattaacactgctgacatctcc
acggtaatctgtgacaaagtcgaaaaagctcaggttctgttggtcaacgtggagcgaaag
aaaacaccaaagctgcgaagaatcattctgatggacgcctttgactctgagctcgagacg
cgtggcaaagcctgtggtgtccatgttcaggccctgcaggaagtcgaggctctgggccgg
gagcactacagaacacctataccgccggcccccgatgatctgtccattgtgtgcttcacc
agtggaacaacaggaaaccccaagggagttatgctcacccatggaaacgtggtggcagat
tttgcaggatttcttaaagtcacagatacagtcatttttccaaaccaagacgattgcctc
atctccttcctgccgctggctcacatgtttgagagactaattgagaacgtggtctactgc
cacggaggacggatcggcttctaccagggagacatccggcttcttcccgaggacatgaag
gccctgcggccaaccattttccccgtggtgcctcggctgctcaaccgcatgtacgacaag
atttttagccaggcaaacaccccggtgaagcgctggctgctcaactttgctgccaagaga
aaaggggccgaagtcagcagaggcatcattcgcaacgacagcgtctgggacaaaatcttc
ttcagtaagattcaggccagcttgggaggacggctcaggatgattataactggagcggct
cctacctcacccagcgtcctgagtttcctcagagcagctctgggttgccaggtatacgag
gcatacggacaaacggagtgcacagctggctgtacctacaccacacctggagactggacc
tcaggtcatgttggcgctccsctgccatgtaacctcattaaactggtggatgttcctgaa
aagaactactttgcatctaaaggagagggagaagtctgcgtgaagggaccaaacgtgttc
aaaggctacctcaaagacccagagagaacggccgagacgctggacgcagaccgttggctc
cacaccggagacatcggcaaatggttaccaaacggcacgctgaagatcatcgacaggaaa
aaacacatcttcaagctggcgcagggcgagtacatctcccctgagaagatcgagaacatc
tacatcaggagcgaaccggtggcgcagctctacgttcacggcgacagtctgcagtcctgc
ttggtgggaatcgtggttcctgaccctgaagtgatgcctgagtgggccaagaagaaaggt
attcagggaacttacaaggacctttgtaaaaacacggaattgaagaaggctatcctggag
gatttggtgcgtctgggcaaagctaatggcctcctgtcgtttgagcaggtgaagaacatc
tacatccacaatgagatgttctccatcgagaacggcctcctgaccccgacgctaaaggcc
aggcgacccgagctgaaggagttcttcaagaagaagatcgacgacctctacagcagcatc
tccatgtga

KEGG   Poecilia reticulata (guppy): 103479395
Entry
103479395         CDS       T05149                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 3-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103479395
   00071 Fatty acid degradation
    103479395
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103479395
  09143 Cell growth and death
   04216 Ferroptosis
    103479395
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103479395
   03320 PPAR signaling pathway
    103479395
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103479395
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103479395
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103479395
  Exosomal proteins of breast cancer cells
   103479395
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 103479395
NCBI-ProteinID: XP_008432017
UniProt: A0A3P9PTD7
LinkDB
Position
LG17
AA seq 709 aa
MKLKEDINPLLLQVFRSVVWVYSVITFLPWYFFSGAGTNLERARRIKACSISGHPAGPYR
AVNSREKLVALVQPGVDTLDKMFEFAARRFPNRDCLGTREVLSEEDELQPNGKVFKKVIL
GNYKWFTYEEAYNAAKCFGSGLAALNQKPHHNIAVFCETRAEWIIAAQACFMYNFPLVTL
YATLGPKAIAHGLNETEVTHIITSKDLLQSRLRAILCDVPRLQYIIVVDIKPTSWSDMPR
GITVYNMEGVKELGSKPVQMDRRQPEPSDIAVIMYTSGSTGIPKGVMISHGNLIAGIAGM
AERIPNLNQTDTYIGYLPLAHVLELSAELVCISHGCRIGYSSPQTLADQSSKIKKGSKGD
TSVLKPTLMASVPEIMDRIYKNVMTKVDEMSKFQKTLFVLAYNYKMEQISKGYSTPLCDR
IVFNRVRSLLGGNTRVLLSGGAPLSAATQRFMNVCMCCPVGQGYGLTETCGAGTISEMWD
YSTGRVGAPLVCSEITLKDWEEGGYHSTDKPNPRGEILIGGPNVTMGYYKSEGRNHEDFF
VDAKGQRWFCTGDIGEFHPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLIDNIC
AYANSEESYVISFVVPNHKHLMGLAEQVQVKGTWEELCNNPKMEKEVLRVITEAAVSGKL
EKFEIPKKIRLSSEPWTPETGLVTDAFKLKRKELKTHYQDDIERMYGGK
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgaagttgaaggaggatataaaccccctgctcctgcaggttttccgctctgtcgtctgg
gtctattccgtcataaccttcctaccctggtacttcttttccggggccggaaccaatttg
gagcgagcgcgtcggattaaggcctgctctatcagcggacacccagcgggaccttacagg
gccgtcaatagccgagaaaagytggtggcactggtgcagccgggagtcgacacactggac
aaaatgttcgagtttgcagcgaggaggtttccaaacagggactgcctgggcaccagggag
gtgctgagtgaggaggatgaactgcagccaaatggaaaagtgtttaaaaaggtgattctg
gggaactataaatggttcacatatgaggaagcctacaatgcagcaaagtgctttggtagt
ggtctggcagctcttaatcagaagcctcaccataacatcgccgttttctgtgagaccaga
gcggagtggattatagcagcgcaggcctgcttcatgtacaatttcccactcgtgacactg
tacgccacactcgggcccaaagccatagctcacgggctgaacgagacagaggtcactcac
atcatcacaagcaaggacttactccagagccgccttagggccattttgtgcgacgtgccg
aggctccagtacatcatcgtcgtggacattaaacccacaagctggtcagacatgcccaga
ggcatcacagtctacaacatggagggtgtgaaggagctgggatccaagcccgttcagatg
gaccgcagacagccggagccctcggacatcgctgtcatcatgtacaccagtggttccact
ggcatccccaagggtgtgatgatctcccatggcaacctcatcgccggcatcgcaggcatg
gccgagcggatcccaaatctcaatcagactgacacttacattggctacctaccactggcc
cacgttctagagctcagcgcagagctggtttgcatctcccacggctgtcgcatcggatat
tcctctcctcagactctcgccgaccagtcctccaagatcaagaagggcagcaaaggggat
accagcgtgctaaaaccgactctcatggcatctgtgccagagatcatggatcgaatttac
aaaaatgtcatgaccaaagtggacgagatgagtaaatttcagaagacgctctttgtgttg
gcgtataactacaagatggagcagatctctaagggctacagtacgcctctctgtgacaga
atagttttcaacagagtgcggtctctgttgggaggcaacactcgggtgctgctttctggt
ggggctccactctcagcggcaacgcagcgcttcatgaacgtctgcatgtgctgcccggtg
ggacagggctacggcctgacagagacgtgtggggctggtaccatcagtgagatgtgggat
tacagtacaggacgtgttggtgcgccgctggtttgctcagagatcacgctgaaggactgg
gaagagggtggctaccacagcactgacaagccaaacccaaggggggaaattttgattgga
ggtccaaatgtaacaatgggttactacaaaagtgaaggcaggaaccatgaagacttcttc
gtggatgcgaagggccagagatggttctgtacgggagacataggagaattccatcctgac
ggatgcctgaagattatcgaccgtaagaaagacttggtgaaactccaggcaggcgaatac
gtctctctcggaaaagtagaggcggttttgaaaaactgcccgctyatagacaatatctgt
gcctacgccaacagtgaagagtcatatgtgatcagctttgtggttcccaaccacaaacac
ctcatgggattggcggagcaggttcaagtaaagggcacgtgggaagagctctgcaacaat
cccaagatggagaaggaggttctccgcgtcataactgaggcggccgtctcaggcaaactg
gagaagttcgagattcccaaaaaratccgcctgagttccgagccgtggacgccggagacc
ggcttggtcaccgacgcgttcaagttgaaacgcaaagagctcaaaacacactaccaagac
gacattgagaggatgtacggtgggaagtaa

KEGG   Poecilia reticulata (guppy): 103481841
Entry
103481841         CDS       T05149                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 5
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00071  Fatty acid degradation
pret01100  Metabolic pathways
pret01212  Fatty acid metabolism
pret03320  PPAR signaling pathway
pret04146  Peroxisome
pret04216  Ferroptosis
pret04920  Adipocytokine signaling pathway
Module
pret_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103481841
   00071 Fatty acid degradation
    103481841
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103481841
  09143 Cell growth and death
   04216 Ferroptosis
    103481841
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103481841
   03320 PPAR signaling pathway
    103481841
Enzymes [BR:pret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103481841
Lipid biosynthesis proteins [BR:pret01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103481841
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103481841
  Exosomal proteins of breast cancer cells
   103481841
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 103481841
NCBI-ProteinID: XP_017166194
LinkDB
Position
LG19
AA seq 525 aa
MDAIFQLLFSPLPTSVVISLIAVGVATLFYLNARPNPVRSPADLNRQTLGVKDGARKTAM
LEDNNNLMSYRYNDAKTLYEVFQRGTKVSGNGPCLGYRKPGKPYQWLKYKQVSDRAQYLG
SGLLHKGLKPNSETFIGIFAQNRPEWIIGEMACYTYSXVVVPLYDTLGPEALVFIINQAG
ISTVLCDNQKKAEALLLNQEKGQTPVLKTVVLMDSFSPELIERGKKCGVDIVSMEDLEAL
GKNNLQKPVESLGGRVRMMVTGAAPISPSVLSFLRAALGCQIFEGYGQTECAAACTFTLP
GDATAGHVGVPLPCNFVKLVDVEEMNYFASNGEGEVCIKGTNVFKGYLKDPEKTAEALDK
DGWLHTGDIGKWLPNGVLKIIDRKKNIFKLAQGEYIAPEKIENVYVRCGPVAQVFVHGDS
LQSSLVAIVVPDADVLPGFAKSLGIQGSIEELCKNTEVKKAIITDMTKLGREAGLKSFEQ
VKDVHLHPELFTIENGLLTPTLKAKRAELKELFQPQIDKLYADIQ
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggacgccatcttccagttgctgttctcacctcttccgacctcagtggttatctccctg
attgcggtcggcgttgcgaccctgttttacctcaacgcccggcccaatccggtccgcagc
ccagccgacctcaaccgccagactctgggtgtcaaggatggtgcaagaaaaacggccatg
ttggaggacaacaacaacctgatgtcatatcgctacaatgatgcaaaaaccctgtatgag
gtctttcaaaggggcaccaaggtttcaggtaacggaccatgtctgggctayagaaagcct
gggaagccttaccagtggctaaagtacaaacaggtgtctgacagggcacagtatctgggg
tcaggactccttcacaaaggtttgaagcccaattctgaaacattcatcggcatctttgct
cagaacagacctgagtggattattggtgagatggcgtgttacacgtactccwtggtagtg
gtccccctgtacgacactctgggtcctgaggctctcgtcttcattatcaaccaagctgga
atctctacggtgctctgtgacaaccagaagaaagcagaagcgctgcttctgaaccaggaa
aaaggccaaactccagttctcaaaactgttgtgctcatggactcattcagccccgagttg
atcgagcgaggaaagaagtgtggtgtggacatcgtgtccatggaggacttggaggcactg
ggaaaaaataaccttcaaaagccagtagagtctctggggggccgtgtgaggatgatggtg
actggcgctgcacccatatcaccatctgttctcagcttcctcagggctgctctaggctgc
cagatctttgaaggatacggtcaracagagtgcgcagctgcctgcaccttcaccttacca
ggagatgccactgctggtcatgttggtgtgcctctgccttgcaattttgtgaagttggtt
gatgtggaagagatgaactactttgcttcaaacggtgaaggagaggtgtgcattaagggc
acaaatgtatttaagggctacttgaaagacccagaaaagactgcagaggccttggacaag
gatggctggcttcacactggtgatattggtaaatggcttccgaatggagtcttgaagatt
attgatcgtaaaaagaacatcttcaagctggctcagggagagtacatcgccccggagaag
atcgagaatgtgtatgtccgctgcggccctgtggcccaagtgtttgtgcatggagacagt
ctgcagtcgagtctggttgccattgtggtacctgatgctgatgtcctgccaggttttgca
aaaagtcttggcatccaaggctccattgaagaactctgcaagaacacagaagttaaaaag
gccataatcacagatatgaccaaactaggaagagaagcaggtctgaagtcatttgagcag
gtgaaagacgtgcatctccaccctgagctcttcaccatcgagaacggcctgctgactccc
accctgaaggcgaagagggctgagctcaaagagctgttccagccacaaattgacaaactt
tatgctgacatccaataa

DBGET integrated database retrieval system