KEGG   Poecilia reticulata (guppy): 103466941
Entry
103466941         CDS       T05149                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04210  Apoptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103466941 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103466941 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103466941 (ikbkg)
   04621 NOD-like receptor signaling pathway
    103466941 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    103466941 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    103466941 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    103466941 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103466941 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103466941 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103466941 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103466941 (ikbkg)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103466941 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Metal_resist
Other DBs
NCBI-GeneID: 103466941
NCBI-ProteinID: XP_008411101
LinkDB
Position
LG7
AA seq 581 aa
MVQPQPDGPMQWDMSGEDSGGTLRVPPELAGNEVVTRLLGDNQQLREALRRSNQALRQRC
EEMEGWQRRTREEREFLSCRFQEARALVERLAQENHSLQSMVNGPGSSSNHSYSSAQMEA
SPGLPARNGPLDEPKTLDQWERKRVEETEQQTQTTPHRSLPAEGANEFLQLLKSHKEKTE
EEMREMRRKNEELKRERDEGKEVLERQHRCIEHLRVKLFHTQTSSNEEAVQLRSEAQHTS
DCSSLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEAL
KAQATSLLGELNERQILLQKSDDERKMLEEKLVSKVKALQAAERELEQQRKQHHVANDKL
LLQVQSLESALKSERHVVTEEKKKLSQLQHAYTCLFRDYDSKLKSEGGDLSSKLEEAERA
LAIKQDLIDKLKEEVEQQKGSLETVPVLTAQAEIYKADFLAEREAREKLNQKKEELQEQF
TQALAEMERLKHELTARARLEQMKLKHMDDFPARPTHIPPQQGFPGVGFNTVPPNRNHVL
APVIDPAAAAAADLPDLCCPKCNYLAPDMDTLQIHVMDCIQ
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggtgcagccacagccggacggccccatgcagtgggacatgtctggagaggacagcgga
gggaccctcagggtcccaccagagctcgctggcaatgaagtggtgaccagactgctgggc
gacaaccagcagctccgagaggctctgcggaggagcaaccaggccctgcgtcagcgctgc
gaagagatggagggatggcagcggcggaccagggaggagcgggaattcctcagctgtcgt
ttccaggaggcccgggcgctggtggagaggctggcgcaggagaaccactctttgcagagc
atggtgaacggaccaggctcatcgtccaaccacagctacagctcggcccagatggaggcg
tcaccggggcttcctgcccggaacggcccgctggatgagccaaagactttagaccagtgg
gagaggaaaagagttgaagaaacggagcagcagacacaaaccacaccacatcgcagcctg
cctgcagagggtgccaatgagttcctgcaactgctgaagagccacaaagaaaaaacagag
gaagagatgagagagatgagaaggaaaaatgaagagttaaagagggaacgggacgaggga
aaagaagtgttagagcgacagcatcgatgcattgagcacctgcgggttaaactgttccat
acacagacgagcagtaatgaggaagctgttcagcttcgctcagaggctcagcacacctct
gactgctctagtctggctaaactcacagagcagcttcaggccacacagggcaggtatcgg
gagctggaggagaaactggattacctgcagaagagctctgctcaacgggacagaacagaa
gctttgctcaaacaaaaggacaaggattgtgcccagttggccaaggactgtgaggctctg
aaagctcaggcgacgtcgctgttgggcgaactgaacgagaggcagatcctcctgcagaag
agcgacgacgagcgcaaaatgctggaggagaagctggtcagcaaggtgaaggccctgcag
gcggcggagcgggagctggagcagcagaggaagcagcatcatgtggccaatgacaagttg
ctgctgcaggtgcagagcctggagagcgcgctgaagtcagagaggcacgtggtcacagag
gagaagaaaaagctgtcacagttgcagcatgcctacacatgtctgttcagagactatgat
tccaaactgaagagcgagggaggagaccttagcagcaagctagaggaggcagagcgggcr
ctggccatcaagcaggacctgatcgataaactaaaggaggaggtggagcagcagaaaggc
tcgctggaaactgtccctgtcctcacagcacaggctgagatctacaaggcagattttctg
gcagagcgagaagcaagagagaagctgaaccagaagaaggaggagctgcaagaacagttc
actcaggctctggctgagatggaacggttgaagcacgagctcacagcacgtgcacgtttg
gagcaaatgaagctgaaacacatggatgattttcctgcacggcccactcacattccccct
cagcaagggtttcctggtgttggcttcaacactgtgccaccgaaccggaaccacgttttg
gcaccggtcatcgatcctgctgcagcagcagctgcagatttgcctgatttatgctgtccg
aagtgcaactacctggctccagatatggacacactgcagatacacgtcatggactgtata
cagtaa

DBGET integrated database retrieval system