KEGG   Poecilia reticulata (guppy): 103466941
Entry
103466941         CDS       T05149                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04210  Apoptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103466941 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103466941 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103466941 (ikbkg)
   04621 NOD-like receptor signaling pathway
    103466941 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    103466941 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    103466941 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    103466941 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103466941 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103466941 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103466941 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103466941 (ikbkg)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103466941 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Metal_resist
Other DBs
NCBI-GeneID: 103466941
NCBI-ProteinID: XP_008411101
LinkDB
Position
LG7
AA seq 581 aa
MVQPQPDGPMQWDMSGEDSGGTLRVPPELAGNEVVTRLLGDNQQLREALRRSNQALRQRC
EEMEGWQRRTREEREFLSCRFQEARALVERLAQENHSLQSMVNGPGSSSNHSYSSAQMEA
SPGLPARNGPLDEPKTLDQWERKRVEETEQQTQTTPHRSLPAEGANEFLQLLKSHKEKTE
EEMREMRRKNEELKRERDEGKEVLERQHRCIEHLRVKLFHTQTSSNEEAVQLRSEAQHTS
DCSSLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEAL
KAQATSLLGELNERQILLQKSDDERKMLEEKLVSKVKALQAAERELEQQRKQHHVANDKL
LLQVQSLESALKSERHVVTEEKKKLSQLQHAYTCLFRDYDSKLKSEGGDLSSKLEEAERA
LAIKQDLIDKLKEEVEQQKGSLETVPVLTAQAEIYKADFLAEREAREKLNQKKEELQEQF
TQALAEMERLKHELTARARLEQMKLKHMDDFPARPTHIPPQQGFPGVGFNTVPPNRNHVL
APVIDPAAAAAADLPDLCCPKCNYLAPDMDTLQIHVMDCIQ
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggtgcagccacagccggacggccccatgcagtgggacatgtctggagaggacagcgga
gggaccctcagggtcccaccagagctcgctggcaatgaagtggtgaccagactgctgggc
gacaaccagcagctccgagaggctctgcggaggagcaaccaggccctgcgtcagcgctgc
gaagagatggagggatggcagcggcggaccagggaggagcgggaattcctcagctgtcgt
ttccaggaggcccgggcgctggtggagaggctggcgcaggagaaccactctttgcagagc
atggtgaacggaccaggctcatcgtccaaccacagctacagctcggcccagatggaggcg
tcaccggggcttcctgcccggaacggcccgctggatgagccaaagactttagaccagtgg
gagaggaaaagagttgaagaaacggagcagcagacacaaaccacaccacatcgcagcctg
cctgcagagggtgccaatgagttcctgcaactgctgaagagccacaaagaaaaaacagag
gaagagatgagagagatgagaaggaaaaatgaagagttaaagagggaacgggacgaggga
aaagaagtgttagagcgacagcatcgatgcattgagcacctgcgggttaaactgttccat
acacagacgagcagtaatgaggaagctgttcagcttcgctcagaggctcagcacacctct
gactgctctagtctggctaaactcacagagcagcttcaggccacacagggcaggtatcgg
gagctggaggagaaactggattacctgcagaagagctctgctcaacgggacagaacagaa
gctttgctcaaacaaaaggacaaggattgtgcccagttggccaaggactgtgaggctctg
aaagctcaggcgacgtcgctgttgggcgaactgaacgagaggcagatcctcctgcagaag
agcgacgacgagcgcaaaatgctggaggagaagctggtcagcaaggtgaaggccctgcag
gcggcggagcgggagctggagcagcagaggaagcagcatcatgtggccaatgacaagttg
ctgctgcaggtgcagagcctggagagcgcgctgaagtcagagaggcacgtggtcacagag
gagaagaaaaagctgtcacagttgcagcatgcctacacatgtctgttcagagactatgat
tccaaactgaagagcgagggaggagaccttagcagcaagctagaggaggcagagcgggcr
ctggccatcaagcaggacctgatcgataaactaaaggaggaggtggagcagcagaaaggc
tcgctggaaactgtccctgtcctcacagcacaggctgagatctacaaggcagattttctg
gcagagcgagaagcaagagagaagctgaaccagaagaaggaggagctgcaagaacagttc
actcaggctctggctgagatggaacggttgaagcacgagctcacagcacgtgcacgtttg
gagcaaatgaagctgaaacacatggatgattttcctgcacggcccactcacattccccct
cagcaagggtttcctggtgttggcttcaacactgtgccaccgaaccggaaccacgttttg
gcaccggtcatcgatcctgctgcagcagcagctgcagatttgcctgatttatgctgtccg
aagtgcaactacctggctccagatatggacacactgcagatacacgtcatggactgtata
cagtaa

KEGG   Poecilia reticulata (guppy): 103470025
Entry
103470025         CDS       T05149                                 

Gene name
ikbkb
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04068  FoxO signaling pathway
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103470025 (ikbkb)
   04068 FoxO signaling pathway
    103470025 (ikbkb)
   04150 mTOR signaling pathway
    103470025 (ikbkb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103470025 (ikbkb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103470025 (ikbkb)
   04621 NOD-like receptor signaling pathway
    103470025 (ikbkb)
   04622 RIG-I-like receptor signaling pathway
    103470025 (ikbkb)
   04623 Cytosolic DNA-sensing pathway
    103470025 (ikbkb)
   04625 C-type lectin receptor signaling pathway
    103470025 (ikbkb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103470025 (ikbkb)
   04920 Adipocytokine signaling pathway
    103470025 (ikbkb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103470025 (ikbkb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103470025 (ikbkb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103470025 (ikbkb)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     103470025 (ikbkb)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103470025 (ikbkb)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TBK1_ULD APH Kdo ubiquitin Glyco_hydro_65m IKKbetaNEMObind
Other DBs
NCBI-GeneID: 103470025
NCBI-ProteinID: XP_008416363
UniProt: A0A3P9P4C8
LinkDB
Position
LG9
AA seq 743 aa
MNRVPLQQPQTCGLWELKERLGTGGFGNVTRWQNKDTEEQIALKQCRQELSERNKERWSL
EIQIMRRLDHVNVVAAREVPQGMQKLVATNDLPLLAMEYCQGGDLRKYLNVLENCCGMRE
GSILILLRDISSALTYLHSKRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQSSLC
TSFVGTLQYLAPELIERQKYTVSVDYWSFGTLVFECITGFRPFLPTWQPVPWHNKVRLKN
DNDIVVYENLSGDIRFSKNLPQPNNLNSLLSERLEKWLQLMLKWSPKERGKDPNNTPSDC
FHQLESILQLKLVHVLNMMSAKILIYAISDDETVANLQLRIEKDTNIPAANQELLLEAGL
VLEPNALASQSAVDYMEVDGRRTDYTLVFLFDCSSCTYEPQFSPRILPENIRFIQKDPRH
SLPYSQLRRTCGQVWHTIRSLKEDWQRLQQGQKAAIMSLLRHNSTLSKQKIEMVSMHQRL
TAKLDFFNTSLHIDMDKYNEQTATGIASEKLLSVWREMEQTALICGQAQVTELEEEMMKL
QPDIVDVQRQPWRSGETLDTLEGKAMELFRKLREKPRDQRTPGDGTETARLMVQAVQFYE
KKLRDFYTVLSKTAMCRHRVMELLPKVEEVVQKLAESEQVLMGLQEKRQKELWDLLKIAC
SKVRSPVSGSPDGLRTPSSVPPLLTPRNSLQQQDESLLEESRTFESRLQSLLHETIQESE
SSMEMLKEWTWLRGEQSFSSDLS
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgaatcgggtccctctgcagcagccgcagacctgcggcctgtgggagctgaaggagcgg
ctcggcaccggaggcttcgggaatgtcaccagatggcagaataaggacacagaggagcag
atcgcgttaaaacagtgccgacaggagctgagcgaaagaaacaaagagcgctggagtctg
gagatccagatcatgaggaggctggaccatgtgaacgtggtcgctgcgcgggaagttcct
caggggatgcagaaactggtggccaccaacgacctgccgctgctcgccatggagtactgc
cagggtggagatctgagaaagtatctgaatgtcctggagaactgctgtggaatgagggag
ggatccattctgattctcttgcgggacatttcttcagctctaacctacctccacagcaag
aggatcatccacagagacctgaaaccggagaacatcgtgctgcagcagggggagaagagg
ctcatccataaaatcatagatctcggctatgctaaggagttggaccagagcagcctctgc
acatcgtttgtgggaacactacagtatctggctccagagcttattgagaggcagaagtac
acggtctctgtggactactggagcttcggcacgctggtgttcgagtgcatcactggattt
cggcctttcttaccaacctggcaacctgttccctggcacaacaaagtcaggctgaagaac
gacaacgacatcgtagtttatgagaacctctctggcgacatccgcttctccaaaaacctg
ccccagcccaacaacctcaacagtctgctatcggagaggctggaaaagtggctccagctc
atgttaaaatggtcgccaaaggagagaggcaaagaccccaataacacgcccagcgactgc
ttccaccagctggagtccatactgcagctcaagctggttcatgtcctgaacatgatgtct
gctaaaatcctgatatacgccatctcggacgacgagacggtagccaaccttcagctgagg
attgaaaaagacaccaacatccctgcagccaatcaggagctgctgctggaagcagggctg
gtcctggagccaaacgcgctcgcctctcagtccgcagtagattacatggaggtagatgga
cgacgaacagactacactcttgttttcttatttgattgctcctcttgcacgtatgagccc
cagtttagtcctcggatacttccagaaaatatccgcttcatccaaaaagatcccagacac
tctcttccgtacagccagctgaggaggacttgcggccaagtgtggcacaccatccgctcc
ctgaaggaagactggcagcggctgcagcaaggccagaaagctgccatcatgagcctcctg
cggcacaactccacgttgtccaaacagaagattgagatggtttccatgcaccagcggctg
acagccaagctggatttcttcaacaccagccttcacatcgacatggacaagtacaacgag
cagacggccacagggatcgcgtcggagaaacttctgagcgtttggagggaaatggagcaa
acggccctcatctgtggtcaggcccaggtgaccgaactggaagaggagatgatgaagctg
cagccagacatcgtggatgtgcagaggcagccgtggaggagcggcgagactttggacacg
ctggaaggaaaagccatggagttgttccgcaaactcagagaaaaacccagagaccagcgg
acgccaggagacggcacagagacggcccgtctgatggttcaggcggtgcagttctacgag
aagaaactcagagatttctacacagtcctcagtaagactgcaatgtgtcgccaccgtgtg
atggagctgctgccgaaggtggaagaagtggtccagaagttggccgagagcgaacaggtt
ctgatgggtctgcaggagaaacgacagaaggagctttgggacctgctgaaaatcgcctgt
agcaaagttcgaagccctgttagcgggagccctgatggactccggacgccttcgtccgtg
cctcctctgttgacccctagaaacagcttgcagcagcaggatgagtctctactggaggag
agcaggacgttcgagagtcgccttcagagtttactgcatgaaaccatccaggagtcggag
agcagcatggagatgctgaaggaatggacgtggctgcgaggagagcagagcttctccagc
gatctctcctga

KEGG   Poecilia reticulata (guppy): 103476976
Entry
103476976         CDS       T05149                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha-like
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04068  FoxO signaling pathway
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103476976
   04068 FoxO signaling pathway
    103476976
   04150 mTOR signaling pathway
    103476976
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103476976
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103476976
   04621 NOD-like receptor signaling pathway
    103476976
   04622 RIG-I-like receptor signaling pathway
    103476976
   04623 Cytosolic DNA-sensing pathway
    103476976
   04625 C-type lectin receptor signaling pathway
    103476976
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103476976
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103476976
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103476976
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103476976
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     103476976
Protein kinases [BR:pret01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103476976
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD YrbL-PhoP_reg APH DUF3887 SSXT
Other DBs
NCBI-GeneID: 103476976
NCBI-ProteinID: XP_008427979
LinkDB
Position
LG15
AA seq 730 aa
MERPTLKKSPTCISWTNKERLGVGGFGHVYLYQHNETGDKIAVKLCRLDLSMKNKERWSR
EIQIMRKLNHVNVVQAREVPEDVTSIALNDLPLLAMEYCAKGDLRKVLNKPENCCGLKES
EVLSLLSDIGSGIQYLHENKIIHRDLKPENIVLQEIDGKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFESQPYTVTVDYWSFGTVIFECICGFRPFLHSMQPVQWINKVKNKGH
KDIMAVEDMNGEIRFSAHLSYPNNLSKPLLEPIESLLRMLLLWDPASRGGGPDPKSNKPQ
CFTLLDNILNMKIMHVLDMTSAQLHSMVLGVEESFLCLQRRLEAQTQAHISPENQELLLE
TGNTLDPRWAPMQCLPDGLRGWDTSIVFLFDKSLTKYSGPLTARPLPDSVNFIVRETKTQ
LPLSPLRKVWGEALSYICGLKEDYLRLYQGQRAAMLSLLRYNSTLTQYKHRLFSYSQQLH
AKLAIFKTSIQQDLEQYTKQSNSGISSEKMQRAWQENEQKADEFTQVANVSGLDEEILAL
HSEIVELQRSPFARRQGDVMEKFEVKAVELYKQLKTKCKSNDPPHGYSDSSDMVRTILQT
VQNQDRVLKDLYTHLSAILMCKQRIVDLFPKLEKAVVNIKAAETEVMQMQTKRQKEFWFL
LKIACAQSNSQLKHKQPSDGETVQQLLDENQRYLNHLTSLMQDVTQELKQNVMDQDWSWV
EFGANKVDSQ
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggagcgtcctaccctgaaaaagagcccgacatgcatcagttggacaaataaagaaaga
ctcggggtgggaggctttggacacgtctacctgtaccaacacaatgagacgggcgacaag
attgctgtgaaactttgccgcctggacctgagtatgaagaataaagaacgctggagcagg
gagattcaaatcatgaggaagctgaatcatgtgaatgttgttcaggccagagaagtccca
gaagatgtgacctccatcgctctcaatgacctacctctgctcgccatggagtactgcgcc
aaaggagatctacgcaaggtgctgaataaaccagaaaactgttgtggactgaaggagagt
gaagtcctgtcacttctcagtgacattggctctggtatccagtatctccatgaaaataag
attattcacagagacctaaaaccagagaacatcgttctgcaagagattgatggaaagctt
gtccataaaatcatagacctgggatatgcaaaagatctggatcaaggaagtctttgtaca
tcctttgttgggactcttcagtacctggctccagagttgtttgagagtcagccatacact
gtgactgtggattactggagctttgggacggttatttttgaatgcatttgcggttttcga
ccttttctgcacagcatgcagccggtacagtggataaacaaagtcaagaacaaaggtcat
aaagacattatggcggtagaggacatgaatggagaaattcggttctcggcacatctgtca
tatcccaacaacctgagcaagccgctgctggagccaatcgagagtctccttcggatgctc
ctactctgggatcctgcttcccgtggcggaggtccagatccaaaatcaaacaagccacaa
tgtttcaccttactggacaatattctcaacatgaagattatgcacgtcttggacatgacg
tcagcccagctgcactcgatggttttgggcgtcgaggagagttttctctgcctgcagcgc
cgtctggaggctcagactcaggcgcacatctctcccgagaatcaggagctgctgctggag
acgggaaacaccctcgacccacggtgggcgcccatgcagtgtctgccagacggtttgcgc
ggctgggacacctccatagtgttcctgtttgataagagccttaccaagtactcaggaccc
ctgactgccagacccctgccagacagtgttaactttatcgtcagggaaacaaagacacag
ctgcccctttctcctcttagaaaggtgtggggggaagccctcagctacatatgtggtctt
aaggaggactacctgcggctgtaccaggggcagagagctgcaatgctaagtctgctgcgt
tacaactccaccttgacgcagtacaagcaccgcctcttctcctactcacagcagctccat
gctaagctagccatctttaagaccagcatccagcaggatctcgagcaatacaccaagcag
agcaacagcggcatctcctcagagaagatgcagcgggcatggcaagaaaatgaacagaag
gccgatgagtttacacaggttgcaaacgtgtcgggtcttgacgaagagatattggcgcta
cattctgaaatcgtggagctgcagcggagtccgtttgccaggagacaaggagatgtgatg
gagaagtttgaagtaaaggctgttgaactctacaagcaactgaaaactaaatgcaaaagt
aacgaccctccacatggctacagtgatagctcggacatggtgcggacgatactccaaacc
gttcagaatcaggacagagttttaaaagacctctacactcatctaagtgcaatcctgatg
tgtaagcagcgcatcgtggatttgttccctaaactcgaaaaggccgttgtgaacatcaaa
gctgcggaaactgaagtgatgcaaatgcaaacaaagagacagaaagagttctggttcctt
ctcaagattgcttgtgctcagagcaactctcagcttaaacacaaacagccaagtgacggt
gaaacggttcaacaacttctggatgaaaatcagcgctacctgaatcatcttacatccctg
atgcaagatgtcacccaagaattgaagcaaaatgttatggatcaggactggagctgggtt
gagttcggagcaaacaaagttgattctcagtag

KEGG   Poecilia reticulata (guppy): 103481753
Entry
103481753         CDS       T05149                                 

Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha-like isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04068  FoxO signaling pathway
pret04150  mTOR signaling pathway
pret04210  Apoptosis
pret04620  Toll-like receptor signaling pathway
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04623  Cytosolic DNA-sensing pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103481753
   04068 FoxO signaling pathway
    103481753
   04150 mTOR signaling pathway
    103481753
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103481753
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103481753
   04621 NOD-like receptor signaling pathway
    103481753
   04622 RIG-I-like receptor signaling pathway
    103481753
   04623 Cytosolic DNA-sensing pathway
    103481753
   04625 C-type lectin receptor signaling pathway
    103481753
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103481753
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103481753
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103481753
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103481753
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     103481753
Protein kinases [BR:pret01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103481753
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD Kinase-like APH
Other DBs
NCBI-GeneID: 103481753
NCBI-ProteinID: XP_008435699
LinkDB
Position
LG19
AA seq 776 aa
MRCSDLNTALPTTMEKAPFKQTQSFGDWELKERLGIGGFAHVYLFQQSETNEKIAVKMCR
LDLTPRNRDRWCREIQIMKKLHHNNVVTAKEVPEDINAIALNELPLLAMEYCSKGDLRNV
LSKPENCCGLKESEVLSLLHDVGSGIQYLHENKIIHRDLKPENIVLQDCGGKVVHKIIDL
GYAKDLDQGSLCTSFVGTLQYLAPELFDNKPYTVAVDFWSFGTMVFECCCGFRPFLHNWQ
PVQWAGIVKNKGPKDIMAVEDSNGEVKFSTHLAQPNNLSRTLVEPLENVLQLMLKWNQEQ
RGGPVQRASKRPMCFEMLDDLLNMSVVHILNMTTAQVLSFKLSPDESLHSLQMRIEAETK
IEVVNQELLQETGVSLDPRKPANQCVPLDGMRGWDEYIVYLFDKSITNYSGPLNARHLPD
RVNNIVQDSKKSLPLVELKKVWGEAVNYICGLKDDYSRLFQGQRAAMLSLLRYNTNLTRC
KNSMFGFSQQLRAKLDFFKSSIQYDLEKYSDQMHYGISSEKMLKAWQENEERAATFAQVA
EVSHLDDEIMALHSEIVELQRSPYARRQGDKMEQLEGKAIDLYMQLKRTCKAADSDGTSD
SSEMVKAIIQTVQNQDKVLKDLYTHLSKILTSKQKIIDLFPRIEKTLESIKDADNTVMQM
QIKRQKEFWHLLKIACAQNSSRNSMAASPESSHLLQVSQWSQSAQPVSSPHPLTSLPGRN
DSDGAPRLLQENQKYLSQLTNLMQEAADEQAKSIVEQDWSWTKYETLTTKLKKRNA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgcgctgcagcgacctgaacacagctctccccacaacaatggagaaagctcccttcaag
cagacccagtccttcggggactgggagctgaaagagaggctggggattggaggctttgcc
catgtttacctcttccagcagtctgaaacaaatgaaaaaatagcagtgaaaatgtgccgt
ctggacctcacaccaaggaacagggacagatggtgcagagaaatacagattatgaaaaag
ctgcatcataataatgttgtgactgcaaaggaagtcccagaggacatcaatgccatcgcc
ttaaacgagcttcccctcctggccatggagtactgctccaaaggagacctgagaaatgtg
ctgagcaaacctgaaaactgctgcggtctgaaagaaagtgaagtgctttcattactccat
gacgtcggaagtggcattcagtatctgcacgaaaacaagatcatacacagggacctgaaa
ccagaaaacatcgttctccaggactgcggtggaaaggtggttcataaaatcattgacttg
ggttatgccaaagatctggaccagggcagtttgtgcacttccttcgtgggaactcttcag
tacctggctcctgagctgtttgacaacaagccatacacggtcgctgtggacttctggagc
tttggaacaatggtttttgaatgctgctgcggtttccgtccctttctgcacaactggcaa
cctgtgcagtgggctggcatagtgaagaataaaggtccaaaagacatcatggccgtagaa
gattctaacggtgaagtcaagttctcaacacatcttgctcaaccaaacaacctcagcagg
acgctggtggaaccgctggaaaacgtcctgcagctgatgctgaagtggaaccaggagcag
agaggcggtccagtgcagcgcgcctcaaaaagacccatgtgctttgagatgctggatgac
ctgctgaacatgagtgtcgtccacatcctgaatatgaccacagctcaggtcctttccttc
aaactgagtccagatgagagtcttcacagtctgcagatgcgcatcgaggccgaaaccaaa
atcgaagtcgtcaaccaggagctgctgcaggagacaggcgtctctctggaccccaggaag
ccggccaaccagtgcgtcccattggacggaatgcgagggtgggacgagtacattgtgtac
ttgtttgataagagcatcaccaactactctggtcccctcaacgccagacacctgcctgac
agagtcaacaacatcgtccaagattcgaagaagtcgctgcctctggttgagttgaagaaa
gtttggggtgaagcggtgaactacatctgtggtctgaaagacgactacagcagactcttc
caaggccagagagctgccatgctgagcctcctgcgctacaacaccaacctgaccaggtgt
aaaaacagcatgttcggcttctctcagcagctcagggccaagctggatttcttcaagagc
agcatccagtatgacctggagaagtacagcgaccagatgcactatgggatatcgtctgag
aagatgctgaaagcctggcaggaaaatgaagaaagagctgctacctttgcacaggtggca
gaagtgagccatttagatgacgagatcatggctctgcactccgagatcgtggagcttcag
aggagcccatacgctcggcgacaaggagacaagatggagcagctagaaggaaaggcaata
gacctctacatgcagctgaagaggacatgcaaagctgctgactcggatggcaccagcgac
agctctgaaatggtgaaggccatcatccagaccgtccagaaccaggacaaggtcctcaaa
gatctgtacacccacctcagcaaaatcctgactagcaagcagaagatcattgatttgttt
ccacggatcgagaaaactctggagagcatcaaagacgcggacaacaccgtgatgcagatg
cagatcaaaaggcagaaagagttctggcatttactcaagatcgcttgtgcccagaactcg
tctcggaactccatggcagccagtcctgagtcgtcccacctgctgcaggtttcccagtgg
tcccagtcggctcagccggtcagctcccctcatcccctgacctccctgcccggacgcaac
gacagtgatggagcgcctcgactgctgcaggagaaccagaagtacctcagtcagctgacc
aatctgatgcaggaggccgcagacgaacaagcaaagagcatagtggagcaggactggagc
tggacaaaatatgaaactttaacaacaaaactaaagaagcgaaacgcgtaa

DBGET integrated database retrieval system