KEGG   Poecilia reticulata (guppy): 103467091
Entry
103467091         CDS       T05149                                 

Gene name
mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04012  ErbB signaling pathway
pret04136  Autophagy - other
pret04140  Autophagy - animal
pret04150  mTOR signaling pathway
pret04218  Cellular senescence
pret04371  Apelin signaling pathway
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103467091 (mtor)
   04371 Apelin signaling pathway
    103467091 (mtor)
   04150 mTOR signaling pathway
    103467091 (mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103467091 (mtor)
   04136 Autophagy - other
    103467091 (mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    103467091 (mtor)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103467091 (mtor)
   04920 Adipocytokine signaling pathway
    103467091 (mtor)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103467091 (mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pret01001]
    103467091 (mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103467091 (mtor)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103467091 (mtor)
Protein kinases [BR:pret01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   103467091 (mtor)
Membrane trafficking [BR:pret04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    103467091 (mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom HEAT_2 HEAT HEAT_EZ EPSP_synthase Nipped-B_C Coatomer_E
Other DBs
NCBI-GeneID: 103467091
NCBI-ProteinID: XP_008411370
LinkDB
Position
LG7
AA seq 2374 aa
MTLSCLSYSVYKTMVIMSGTATVLQQFVSGLKSRNEDTRAKSAKDLQHYVTTELRELSQD
EATTFYDELNHHIFELVSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSS
DPVVMEMASKAMGHLSMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVS
APTFFFQQVQPFFDNIFYAVWDPKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTF
EEAEKGFDETLAKEKGMNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDK
YCKELMGFGTKPRHITPFTSFQSVQPQQSNALLGLLGYSTPQSFLGFGATPVPAKSSLVE
SRYCRELMEERFDQVCRWVLKYKTSKNPLIQMTILNLLPRLAAFQPHTFTDQYLSDTMGY
LLGCLKKEKERTSAFQALGLLVVAVRTEIHPYLMKILEIIKAALPPKDFAHKRQKTIQVD
ATVFTCISMLSRAMGPSIQPDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGL
LKMLSLVLMHKPLRHPGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSL
TQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHVVSQTAVQVVADVLSKLLV
VGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSM
NPAFVMPFLRKMLIQILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALIL
KLKDPDPNPGVVISVLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWT
LGQQVASTGYVVEPYRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNI
GMIDQSRDASAVSLSESKSNQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPS
LSNHHTMVVQAVTFIFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVSFV
KIHIRPYMDDIFTLIREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFM
HDNSTGRSVTIKLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALETLDRLT
ESLDFTDYASRIIHPIVRTLDSTPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVMLKHR
INHQRYDILICRIVKGYTLAEEEEDPLIFQHRQIRGNQGDALVSGPVEPGPMKKLHVSTT
ALQKAWGAARKVSKDDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFL
SCWSELSEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLL
GERASKCRAYAKALHYKELEFQKGPSPLILESLISINNKLQQPEAASGVLEYAMKHFGEL
EIQATWYEKLHEWEDALVAYDKKIDMNKEDPELILGRMRCLEALGEWGQLHQQCCEEWTL
VSEETQAKMARMAAAAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQC
IDKARDLLDAELTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRETWWERL
QGCQRIVEDWQRILMVRSLVISPHEDMRTWLKYASLCGKSLRLALAHKTLVLLLGVDPSK
QLDHPLPTTHPHVTYAYMKYMWKSSRKIDAFQHMQHFVQGVQQQAQHAIAAEDHQRKQEL
HKLMARCFLKLGEWQLSLQGINESTIPKVLQYYSSSTEHDRNWYKAWHAWAVMNFEAVLH
YKHQNQGRDEKKKRRHGSGASAASEASNSDSEVDSTDHSPMPSPGQKKVNEDLSKTLLLY
TVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIP
QLIARIDTPRALVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCE
HCNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMER
GPQTLKETSFNQAYGRDLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTS
LELQYVSPKLLMCXDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTIMGSNGH
EFMFLLKGHEDLRQDERVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWV
PHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLA
KLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGD
CFEVAMTREKFPEKIPFRLTRMLTNAMEVMLWER
NT seq 7125 nt   +upstreamnt  +downstreamnt
atgaccctatcttgcctcagctacagtgtctataaaaccatggtgatcatgtcagggaca
gccactgtgctgcagcagtttgtcagcgggctgaagagcagaaatgaagacaccagagca
aaatctgccaaagatctgcagcactatgtcaccacggagctcagagagctgagccaagat
gaagccacaacattctacgatgagttaaaccaccacatatttgagctggtatccagctct
gacgtgaatgagaagaaagggggcatccttgctatagtgagtctgatcggagtagaggga
ggcaatgccaccaggatcagtcgattcgccaactacctccgtaacctgctcccttccagt
gatccagtggttatggagatggcctctaaagccatgggccacctatcgatggcaggagac
acgtttactgccgagtatgtggagtttgaggtgaagcgggctctggagtggctgggagcc
gacaggaatgaagggagacgccatgcagcggtgttggtgttgagagagctggctgtgagt
gcgccgaccttcttctttcagcaagtgcagcctttctttgacaacatcttctacgcggtg
tgggatccgaagcaggccattcgagagggagcagtgtctgctctgcgggcctgtctcatc
ctcaccacgcagagggagaccaaggaaatgcagaagcctcagtggtataaacaaaccttt
gaggaggcagaaaaaggctttgatgagactctggccaaggagaaggggatgaatcgtgac
gatagagttcatggtgcgctgctgatcctcaacgagttggtccggatcagcagcatggag
ggagagcgaatgcgcgaagagatggaggagatcacccagcagcagctggttcatgataaa
tactgcaaggagctgatgggatttggaacaaagcctcgccacatcacgcctttcaccagc
ttccagtcagtgcaaccacagcagtccaacgccctgctggggttgctaggctacagcacg
ccgcaaagtttcctgggcttcggcgccacgccggtacctgccaagagctccctggtggag
agccggtactgccgagagctgatggaggaaagattcgaccaggtgtgtcgttgggttctg
aagtataaaaccagtaagaaccctctgattcagatgaccatcctcaacctgctgccgcgt
ctagctgccttccagccacataccttcacagaccagtacctgtctgacaccatgggctac
ctgctgggctgcctgaagaaggagaaggagaggacatcggctttccaggctctggggctg
ctggtggtggccgtcaggacggaaatccatccgtacctcatgaagattctggagatcatc
aaggctgctctgcctcccaaggactttgctcacaaaaggcagaagaccattcaggtggat
gccactgtgttcacctgcattagcatgctgtccagagccatgggccccagcatccagcca
gacatcaaggagctcctagagcccatgctagccgtggggctcagtccggcactcacagca
gtgctgtacgacctgagccgtcaaatcccccagctgaaaaaagacatccaggacggcttg
ctgaagatgctttccctggtgctgatgcacaagcccctgcgacacccaggtatgcccaaa
ggcctggctcaccagctggcctctcccagtctcaccaacatccctgaggccagcgacgtc
ggcagcatcactttagccctgcgcactctgggaagctttgaattcgaaggtcactccctg
actcagtttgtgcgccactgtgccgatcacttcttgaacagcgaacataaggaaatccga
atggaggcagcccgaacttgctctcgacttctcacgccgtccatccatctcatcagcggc
cacgtcgtcagccagactgctgtgcaggtggtcgcagatgtgctcagcaagctgctggtg
gttggcatcactgatccagatccagacattcgatactgtgttcttgcgtctcttgatgag
cgttttgatgcgcacctggcccaggccgagaatctgcaggctctgtttgtggctttgaac
gacgaagtgtttgaaatcagagagctggccatctgcactataggacggctgagcagcatg
aaccctgccttcgtcatgcccttcctccggaagatgttgatccagattttaaccgaactg
gaacacagtggtgttggcaggaacaaagagcaaagcgctcgtatgcttggccacctggtc
tccaatgcaccccgtctcatacgaccctatatggaacccattctcaaggctctaattctg
aagcttaaagatccagatcccaaccctggagtggtgatcagtgtcctcgctacaatcggc
gagctggcccaggtgagcggactggagatgaggaagtggatggatgagctgttcccaatc
atcatggacatgctgcaggactcgtcctcattggctaagcgccaagtggcgctgtggact
ctgggtcagcaggtagcgagtacaggctacgtggtggaaccgtaccgcaaatacccttcc
cttctagaagtgctgctcaacttcctaaaaacggagcaaaaccaggggatcaggagagag
gccatccgagtcctgggtctgctcggcgctctggatccctacaagcacaaggtgaacatc
ggcatgatcgatcagtcacgggatgcctctgcagtcagcctctctgaatccaagtctaac
caggactctgcggactacagcaccagtgaaatgctggtgaacatgggcaacctgcccctg
gacgagttctacccagcggtggccatcgtcactttgatgcgaatcctcagagacccctcg
ctgtccaaccaccacaccatggtcgttcaggccgtcaccttcatcttcaagtcgctgggc
ctcaagtgcgtccagttcctgccacaggtcatgcccacgttcctcaacgtcatccgcgtt
tgcgacgccagcatccgagagttcctcttccagcagatgggaatggttgtgtcctttgtg
aagattcacatccggccatacatggacgacattttcaccctgatcagagagtactggaca
ccaaacaaccccatgcagaacaccatcatcctcctcatcgagcaaattgtggtggcgctg
ggcggagagttcaagctctacctgcctcagctcatcccacacatgctgcgtgttttcatg
cacgataacagcaccggccgcagcgtcaccatcaagctgctgaacgccatccagctgttt
ggtgccaatctggatgactacctccacttattgctgcctcctattgtcaagctatttgat
gccccagatgtgcccctccaggctcgcaaggtcgccctggagacgctcgaccgactaacg
gagtccttggacttcacagactatgcttcccgcattatccacccgattgttcggacactg
gacagcacgccggagctgcgctccaccgccatggacaccctgtcctcgctggtgttccag
ctggggaagaagtaccagattttcatccctatggtcaacaaagtgatgctgaagcaccgg
atcaatcaccagcgctacgacattctgatatgtcgtattgtgaagggctacacactggca
gaggaggaagaggaccctttaatctttcaacaccggcagattcggggcaaccaaggcgac
gctctggtcagcggtcccgtagagccaggccccatgaagaaactccatgttagcacgacc
gcactccagaaggcctggggtgctgctcggaaagtgtccaaggatgactggctggagtgg
ctgaggcgtctgagcgtggtcctgctcaaagagtcgtcctccccggctctgcgatcgtgc
tggtctctggcgcagacatacatccctcttgccagagacctgttcaacgctgcttttctg
tcctgttggtcagagctgagtgaagaccagcaggatgagcttatccgcagcatcgagtta
gctctcacctctcaagatatagccgaggtgacgcaaacgcttcttaacttggcagaattc
atggagcacagtgataagggccctctgcccctcagagacgataatggcatcgttctgctt
ggagagagagcctccaaatgtcgtgcctatgccaaggcactgcattacaaagagctggag
ttccagaaaggcccctctcctctcatcttggagtctctaatcagcatcaacaacaaactg
cagcagccagaggcggcatcaggagttctagaatatgcaatgaaacattttggtgaactg
gaaatccaagccacttggtatgagaagcttcatgagtgggaggacgccctggtggcttat
gacaagaagatcgacatgaacaaagaggatccggagctgatcctgggcaggatgcgctgc
ttggaggccttgggagaatggggtcagctgcaccagcagtgctgtgaagagtggacgctg
gtcagtgaagagactcaggccaagatggcgcgtatggccgctgcagctgcctggggtcta
ggacactgggatagcatggaggagtatacatgtatgatccccagagacacacacgacggc
gctttttacagagcagttctagctctccatcaggaccttttctcattggctcaacagtgc
attgacaaagccagagacctcctggatgctgagctgacggccatggctggagagagctac
agccgtgcctatggggccatggtgtcctgccagatgctgtctgagctggaggaagtaatc
cagtacaaactggtgccggagcggagggacatcatcagggaaacttggtgggagaggctg
cagggttgtcagcgcattgtggaagactggcagcggatcctgatggtccgctctctcgtc
atcagcccccatgaagatatgagaacttggctgaaatatgccagcctttgtggcaagagc
ttacgcctggctctggcccataagaccctcgtgctcctccttggtgttgacccctccaag
cagctcgaccacccgctgcccaccacccacccacacgtcacatatgcatacatgaagtac
atgtggaagagtagccgcaagattgatgccttccagcacatgcagcattttgtccaggga
gtccagcagcaagcccaacatgccatagcagctgaagaccatcagcgcaagcaggagctc
cacaagctgatggccaggtgcttcttaaagctgggggagtggcagctaagcctgcaaggc
atcaatgagagcaccatccctaaagtccttcagtattacagcagttcaacagagcatgac
cgcaactggtacaaggcctggcatgcgtgggccgtcatgaacttcgaggcagtgctccac
tacaagcaccagaaccagggtcgcgatgagaagaagaaacggcgacacggcagcggggcg
agcgccgccagcgaggccagcaatagcgacagtgaggtggacagcaccgaccacagtccc
atgccctcaccgggccagaagaaggtcaatgaggacctctcaaagactttgctgctctac
acagtacctgctgttcagggtttcttccgctccatttccctctccagaggaaataacctg
caggacacactcagggttttgacgttgtggtttgattacggccactggcctgaggtgaac
gaagctttggtggagggaatcaagaccattcagatagacacctggttacaggtgattcct
cagctcatagctcgtatcgacacgcctcgagcactggttggccgtctcatccaccagctg
ctgacagacatcggccgttaccatccgcaggctttgatctacccgctcaccgtggcctca
aagtccaccaccaccgcccggcacaatgctgctaacaagatcctgaagaacatgtgtgaa
cactgcaacaccctggttcaacaagcaatgatggtgagcgaggagcttatccgcgtcgct
atcttgtggcatgagatgtggcacgagggccttgaggaagcttctcgtctttactttggc
gagcgtaatgtaaagggcatgtttgctgtcctggagccactgcatgccatgatggagaga
ggaccacaaaccctcaaagagacttcattcaaccaggcttacggcagagatttgatggag
gcccaggactggtgcaggaagtacatgcgctctgggaatgtgaaagacctgacgcaggcc
tgggacctttactaccacgtgttcagacgcatctccaagcagctgcctcagctcacctcc
ctggagctgcagtacgtttctcccaagctgctgatgtgtygcgacctggagctggctgtg
cctggcacgtacgaccccaaccagcctatcattcgcatccagtccatcgctccctcgctg
caggtcatcacctccaagcagcgcccacgcaagctcaccatcatgggaagcaatggccat
gagttcatgttcctgctgaagggccacgaggacctgaggcaggacgagagagtcatgcag
ctgttcggcctggtcaacacgctgctggccaacgacccagcgtctctgcgcaaaaacctc
agcattcagcgctacgccgtcatccctctttccaccaactcgggcctgattggctgggtg
ccccactgcgacacgctgcacgccctcatcagagactacagagagaagaaaaagattttg
ctcaacattgaacatcgcatcatgctcagaatggcaccggactacgaccatctgacgctg
atggagaaggtggaggtgttcgagcacgccgtcaacaacacggctggagacgacctggcc
aagctcctgtggctgaagagccccagttctgaggtgtggtttgacaggagaaccaactac
actcgctccctggctgtgatgtccatggtgggctacatcctgggtctgggcgacagacat
ccatccaacctgatgctcgatcggctcagcggcaagatcctccacattgactttggagac
tgttttgaagtggcgatgaccagggagaagtttcctgagaagatcccgttcagactgacg
aggatgctaacaaatgccatggaggtaatgctgtgggaacgttga

DBGET integrated database retrieval system