KEGG   Poecilia reticulata (guppy): 103467098
Entry
103467098         CDS       T05149                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103467098
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103467098
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103467098
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     103467098
Protein phosphatases and associated proteins [BR:pret01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    103467098
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 103467098
NCBI-ProteinID: XP_008411382
UniProt: A0A3P9P4Z3
LinkDB
Position
LG7
AA seq 594 aa
MTSRRWFHPNITGIEAEQVLLTRGVHGSFLARPSKSNPGDFTLSVRRNNEVTHIKIQNSG
DYYDLYGGEKFATLAELVQYYTEQQDLLRERNGHVIELKYPLNCKDPTSERWYHGHLSGR
DAEKLLTEKGKAGSFLVRESQSKPGDFVLSVLTNEEKHDNVDRKTKVTHVMIRFQEGKYD
VGGGERFDTLADLVDHYKKNPMVEKSGIVVHLKQPFNATRINAANIENRVRELNKVADNS
EKPKQGFWEEFEVLQQQECKLLYPRKEGQKPENKSKNRYKNILPFDTTRVVVKDSESDAP
GSDYINANYIRNVSEDGCHVEESKVFIATQGCLQNTVNDFWKMVYQENAHVIVMTTKEME
RGRNKCVRYWPDLNGTKEFGKVLVRNVEEQPAQDYILRKLEVTRLDRKEPLRYIWHYQYL
SWPDHGVPNEPGGVLWFLEEVNCTQSTIKDTGPIIVHCSAGIGRTGTIIVIDILIDIINR
QGLDCDIDIPKTIQMVRQQRSGMVQTEAQYKFIYMAVQQYIDTVQKRLEEEQRNKMKERE
YSNIKYPQMTNSRSKHNMASSRSSSVMTNDDSSSVYENINFRTPQASFSSNTRR
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgacatctcgcaggtggttccaccccaacatcactggaatcgaggcagagcaggtcttg
ttgactcggggagttcacggcagtttcctggcccggcccagcaagagcaatcctggggat
tttactctgtctgtcaggcgtaacaatgaggtgacccacattaagatccagaactctggg
gactactatgacctgtacggtggcgagaagtttgccacgctagccgagctggtgcagtat
tacactgaacagcaggacctgctgcgcgagaggaacggccatgtcattgagctgaagtat
ccactcaactgcaaggatcccacctctgagaggtggtaccatggacacctctctgggaga
gatgcagagaaactcctcacagaaaaaggcaaagccggcagctttctggtccgggagagt
cagagtaaacctggagactttgtcctgtcggttctcaccaacgaggagaagcatgacaac
gtcgaccgcaaaaccaaagtcacacatgttatgattcgcttccaggaaggcaagtatgat
gtgggaggtggtgaacggtttgacacgttggccgatctggtggatcactacaagaagaac
cccatggtggaaaaaagtggcattgtagtacatctcaaacagccttttaacgccacgagg
ataaatgctgccaacatcgagaaccgggtacgagaactcaacaaagtagcagacaactca
gagaagccaaaacaaggattctgggaggagtttgaggtacttcagcagcaagagtgcaaa
ctgctgtatccccggaaagagggccagaagccagaaaacaagagtaaaaacagatacaag
aacatcctccccttcgacacaacgcgagttgtggttaaagactctgaatcagacgctccg
ggttcagattacatcaacgctaactatatcagaaacgtgagtgaagatgggtgccatgtg
gaggagagtaaagtcttcattgccactcagggttgcctgcagaacacggtgaacgacttc
tggaagatggtgtatcaggagaatgctcacgtcattgtcatgacaaccaaggagatggag
cggggaaggaacaaatgcgtccggtactggccggacctcaatggcactaaagagtttggg
aaagtcctggtgaggaatgtggaagagcagccggcgcaggactacatcctgaggaagctg
gaggtgacacgcctggacaggaaggagcctctgcggtacatctggcactaccagtacctg
agctggccggaccacggcgtccccaacgagcccggtggcgtcctctggttcttggaggaa
gtcaactgcacacagagcactattaaggatactggacccatcattgtccactgcagcgcg
ggcatcggcagaaccggcaccatcatcgtcatcgacatcctcatcgacatcatcaaccgc
caagggctggactgtgacatcgatatcccaaagaccatccagatggtccggcagcaacgg
tccggcatggtccagactgaggcacagtacaagttcatctacatggcagtgcagcagtac
atagacacggtccagaagaggctggaggaggagcagaggaataaaatgaaggagagagaa
tattcaaacatcaartatccacagatgaccaactccaggtctaagcacaacatggcgtcc
tccaggtcgtcttcagtaatgacaaatgatgattcttcgagcgtgtacgagaatataaac
ttcagaaccccccaggcatcgttcagtagtaacaccaggagataa

KEGG   Poecilia reticulata (guppy): 103473239
Entry
103473239         CDS       T05149                                 

Gene name
ptpn11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04625  C-type lectin receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103473239 (ptpn11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103473239 (ptpn11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103473239 (ptpn11)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     103473239 (ptpn11)
Protein phosphatases and associated proteins [BR:pret01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    103473239 (ptpn11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 103473239
NCBI-ProteinID: XP_008421537
UniProt: A0A3P9PS14
LinkDB
Position
LG12
AA seq 596 aa
MTSRRWFHPNISGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGR
DAEKLLTEKGKNGSFLVRESQSHPGDFVLSVRTGDDKTDTNDGKPKVTHVMIRCQGDLKY
DVGGGEKFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAEA
TDKVKQGFWEEFETLQQQECKLLYSRKEGQRPENKNKNRYKNILPFDHSRVVLNDGDPSE
AGSDYINANIIMPEADSKCNNAKPKKSYIATQGCLQNTISDFWRMVFQENSRVIVMTTKE
VERGKSKCVKYWPEMSALKEYGAMRVRNVKETKAHDFILRELKLSEVGQGNTERTVWQYH
FRTWPDHGVPADPGGVLDFLEEVNLKQESILDAGPITVHCSAGIGRTGTFIVIDILIDVI
REKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEELKSKIKG
REYTNIKYSLSDLSGGEQSPLPLCSPSPTPVCTEMRDDSSRVYENVGLMQQQKTFR
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgacatctcggaggtggtttcaccccaacatctcaggcgtggaggcggagaacctcctg
ctgacccgaggagtggacgggagctttttagccagacccagcaaaagcaatccaggagac
ttcaccctctcagtacggcgaaatggagccgtcacccacattaagatccaaaacacagga
gactactacgacctgtacggcggggagaagtttgccacgctagctgagctggtgcagtat
tacatggagcatcatgggcaactgaaggagaaaaacggagacgttatcgagctcaagtat
ccgctcaactgtgccgacccaacatcagagagatggttccacggacatctgtcaggccgc
gacgcggagaagctgctgacggagaaaggcaagaatggcagctttctggtgagggagagc
cagagccaccctggggactttgttctgtcggtccgcacaggagacgacaaaacggacacc
aacgacggcaaacccaaggtcactcacgtcatgatccgctgccagggtgacctgaagtac
gacgttgggggaggagagaagttcgactccctcacagaccttgtagaacactacaagaaa
aaccccatggtggaaactcttggcaccgtcctccagctgaagcagccgctgaacactacc
cgcattaacgcagccgagatcgaaagtcgagttcgggagctgagcaagctggcagaggcc
acggacaaggtcaagcaaggcttctgggaagaatttgagactctgcagcaacaggagtgc
aagttgctctacagccgcaaagagggtcagcgaccagaaaacaaaaacaagaacagatac
aagaacattttgcctttcgaccactcgcgcgtcgtgctgaacgatggcgacccgagcgag
gctggctctgactacatcaacgccaacatcatcatgcctgaggcagactctaagtgcaac
aacgccaagccgaagaagagctacattgccactcagggttgtttgcagaacaccatcagt
gacttctggaggatggtgtttcaggagaactctcgggtcatcgtgatgaccaccaaagag
gtggaacgagggaagagcaagtgtgtgaagtattggcctgagatgtcggctctgaaggag
tacggcgcaatgcgcgtccgcaacgtcaaggagacgaaagctcacgacttcatcctcaga
gaactgaagctgtccgaagttggtcagggtaacacagaacgcacagtgtggcagtaccac
ttcagaacctggccggaccacggcgtccccgctgacccgggcggcgtgctggacttcttg
gaggaagtcaacctgaaacaggagagcattttggatgctgggcccataacagtacactgc
agtgcagggatcggacggacagggacatttatagtgatcgacatcctgattgatgtgatc
agagaaaaaggggtggactgtgacatcgacgtgccgaagaccatccagatggttcgctcc
cagcgctcggggatggtgcagacggaggcgcagtaccggttcatctacatggccgtgcag
cactacatagaaacactgcagaggcgcatcgaggaggagctgaaaagcaagatcaaagga
cgcgagtacaccaacatcaagtactcgttgtccgacctgtccggcggagagcagagcccc
ttaccgctctgctcgcccagtccgactcccgtctgcacagagatgagggacgacagctcc
agagtttatgagaacgtggggctgatgcaacagcagaagaccttcagatga

DBGET integrated database retrieval system