KEGG   Poecilia reticulata (guppy): 103467308
Entry
103467308         CDS       T05149                                 

Definition
(RefSeq) signal transducer and activator of transcription 6-like isoform X1
  KO
K11225  signal transducer and activator of transcription 6
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103467308
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103467308
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103467308
SSDB
Motif
Pfam: STAT_bind STAT_int STAT_alpha SH2 Cbl_N3
Other DBs
NCBI-GeneID: 103467308
NCBI-ProteinID: XP_008411793
LinkDB
Position
LG7
AA seq 723 aa
MAQWLEMSYVLTDMDDERINALYPPDTFPIEIRHYLCQWMEEKDWEGFSPDQSDKEPLAQ
ALLSDAVLLLESVADQQNIVERMKLVQITKNMMTRPAMEFAVKIRNIFRQEKMILCERLA
NKRAEGKTPDFEDLSFLKNTVFQLQDRRKRIHSCQEDINWEMVNFEALQSVHAKSPAERS
LRELQVLSKKIQELKINQSSLIQECLGVFTETLTKLKQCQDNFIVKMNVWQWEQHKSVIG
YPFTDDLSHLQNWSEKLFAVNSNLRQEWLLIPDLPKEIGEKLTGLLQELIQSSFVVEKQP
PQVIKTQSKFSAVVRYLLGESLVSGQPVTMKAQIINELQARNVNLALCDNVGELINHTAI
LDRNTATKTTNANFRHMSIKKIKRADRKGAESVTEEKFALMFLAEIFITGHETPFKIHIN
SQPVVVIVHGSQDINAVATIIWDCAFAEPDRVPFVVPDRVTWKMMIETLNVKFCSEVGTN
HNLNPYNKHFLAQKIFDQPEYANDLSDSVVTWCQFNKEVLAGRNFTFWQWFEGAMDLTKK
HLKPYWSDGLIFGFIGKQHVHLILKESPSGTFILRFSDSEIGGITIAYVSHENGIPMIQN
IQPFTRKDLEIRCLGDRIRDINEILYLYPNVSKHEGFKKFYTEQQPTNSGYIPVSLQTKV
GTVPEIDGSHVSGELSALNVEDTYSLDTLPDLNGLSMDAHCDPVPPDGMEYDFYFNEFTK
NST
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcccagtggttggagatgagttatgtcctgactgacatggacgatgagcgaatcaac
gcgctctatccgccagacaccttcccgattgaaatcaggcattatctttgccaatggatg
gaagaaaaagattgggaaggtttcagcccagaccagtcggacaaagagcctctcgcgcag
gctttactgagcgacgctgtcctcctcttagaatcggttgctgaccagcagaatatagtg
gagaggatgaagctggtgcagataacaaagaacatgatgactcggccagctatggagttt
gctgtgaagatcaggaacattttcaggcaggagaagatgatactctgtgagaggctcgcc
aataaacgggcagaagggaagactcctgactttgaggatttgagtttcttgaagaataca
gtgtttcagctccaggaccgcagaaaaagaatccacagctgtcaagaggatatcaactgg
gagatggtaaactttgaagctctgcaatccgttcatgcaaagtctccagcggaacgttca
ctcagagaactacaggtgctgtcgaagaaaatccaggagctcaagataaatcaaagcagt
ctaatccaggaatgtttgggggtgttcacagagactctgaccaagctgaaacagtgtcag
gataattttatcgtaaagatgaatgtatggcagtgggagcagcacaaatccgttatagga
tatcctttcactgatgacctcagccatctgcagaactggtctgaaaagctgtttgcggtg
aacagtaaccttcgacaggagtggctgctgatccctgatcttccaaaggaaatcggagaa
aaactgacgggtcttcttcaggagctgattcaaagctctttcgttgtggaaaaacaaccc
cctcaggtcattaaaactcagtcaaagttctccgcagttgtgagatatctgctgggggaa
tcgctggtgtctgggcagcctgtgacaatgaaggcacaaattattaatgaactccaagcc
agaaacgtgaaccttgcattgtgcgacaatgtcggagaactcataaaccacacagcaatc
ctggatagaaacacagccacaaagaccacaaacgccaacttcagacacatgtccattaaa
aaaataaagcgagcagaccggaagggagccgaatctgtgacagaggagaagtttgcgctg
atgtttctagcagagattttcatcacaggtcatgagactcctttcaagatacatataaac
tctcagcctgtggtcgtcattgttcacggcagtcaggacatcaacgccgtggccaccatc
atctgggattgtgcgtttgctgaaccagaccgagtgccctttgtcgtcccggatcgtgtg
acttggaagatgatgattgaaactctgaatgttaaattttgctcagaggtcgggacaaat
cacaacctgaacccctacaacaagcacttcttggctcagaagatctttgaccagcctgaa
tatgcgaatgacttaagcgattctgtggttacttggtgccagtttaataaagaggtcctc
gcgggtcgaaatttcactttctggcagtggtttgagggagcaatggatctcaccaagaaa
catctgaagccctactggagtgacgggctgatttttggtttcattggaaagcaacatgtc
cacctgattctcaaagagtctcccagcgggactttcatccttcgcttcagtgactcagaa
atcggaggcatcaccatcgcttatgtttctcatgagaatgggataccaatgattcagaac
attcaacctttcaccaggaaagatctcgagatccgctgcctcggcgaccgcattcgggac
attaatgagatcttgtacctctatccaaatgtgtccaaacatgagggtttcaagaagttc
tacacagagcaacagcccaccaattcgggctacattcccgtaagtctgcagactaaagtt
ggcacggtaccagagatcgatgggagtcatgtcagtggtgaactgagcgcgctgaatgtc
gaagacacctactcattagatacattaccagacttgaatggcctttccatggacgcacac
tgcgaccccgttcccccagatggcatggaatacgacttttatttcaatgaatttactaag
aactctacttga

DBGET integrated database retrieval system