KEGG   Poecilia reticulata (guppy): 103468244Help
Entry
103468244         CDS       T05149                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00590  Arachidonic acid metabolism
pret01100  Metabolic pathways
pret04370  VEGF signaling pathway
pret04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103468244 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103468244 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103468244 (ptgs2)
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103468244 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF Toxin_27
Motif
Other DBs
NCBI-GeneID: 103468244
NCBI-ProteinID: XP_008413384
LinkDB All DBs
Position
LG8
AA seq 615 aa AA seqDB search
MNRVHSRMDFITFSTLLLAISFSLCKGGNPCCSEPCQNRGVCTAMGSQDYECDCTRTGFY
GQNCTTPEFLTWVKVSLKPSPNTVHYILTHFKGFWNIINNISFLRDAIMKYVLTSRSHMI
DSPPTYNADYGYKSWEAYSNLSYYTRTLPPVPADCPTPMGVVGKKELPDVKVLAEKLLVR
RRFIPDPQGTSLMFAFFAQHFTHQFFKSDMKNGPAFTVAKGHGVDLGHIYGDNLERQHKL
RLFKDGKLKYQIVNGEVYPPLVKDVGAEMQYPPHIPDSQRFAVGHEAFGLVPGLMMYATI
WLREHNRVCDILKEVHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE
LLFSKRFQYQNRIASEFNTLYHWHPLMPDSFHIEERDYSYKEFVFNTTVMTEHGISNLVD
SFTKQTAGRVAGGRNVPGPILYVAIKSIENSRKMRYQSLNAYRKRFFMEPYSSFEDMTGD
KEMAAILEELYGDIDAVELYPGLLVEKPRLNAIFGETMVEMGAPFSLKGLMGNPICSPEY
WKPSTFGGSVGFDIVNTASLQRLVCNNVQGPCPVASFYVPDIKETGSMTINSSTSQSRGS
NPNPTVILKERTSEL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagtacatagcagaatggatttcataacattttctactttactgctggcaatc
agtttttctctatgcaaaggaggtaacccctgctgctcagagccatgccagaacaggggt
gtgtgcacagcgatgggttcacaagactatgaatgcgactgcacacgcactggtttttat
ggacaaaactgcacaacacctgagttcctcacttgggtaaaagtttccctaaagccttca
cccaacacggtgcactacatcctcacccacttcaagggattctggaacatcatcaacaat
atttcatttctcagagatgccatcatgaaatacgtcttgacatcacgatcccatatgatt
gacagtcctcctacttacaatgcggactatggatacaaaagctgggaagcctattccaac
ctgtcctactatactcgtacccttcctccagttccggcggactgcccaacccctatggga
gtcgtaggtaaaaaggagctacctgatgtcaaggttttggcggaaaagctcttggtgagg
agacggtttattccagacccgcagggtaccagcttgatgtttgcgttcttcgcgcaacac
ttcacacaccagttcttcaagtctgatatgaagaacgggcctgctttcacagtggctaaa
ggccacggggttgatctcggccacatttatggtgacaacctggagaggcaacataaactg
aggcttttcaaggatggaaagcttaaatatcagattgtaaacggagaggtgtaccctccg
ctggttaaggatgttggtgctgaaatgcagtacccgccacacatcccagactctcagcgc
ttcgctgttggccacgaggcgttcggtctggtcccaggcctcatgatgtacgccaccatc
tggctccgtgagcacaaccgggtgtgtgacattttgaaggaagttcacccagactgggat
gatgaaagactctttcagacttctcggctcatccttattggtgagaccatcaagattgtg
atcgaggactacgtgcagcacctgagcggttatcacttcaaactgaagtttgatccagag
ctgctcttcagcaaacgcttccagtaccaaaaccgcatcgcatccgagttcaatacactt
taccactggcaccctctgatgcctgacagcttccacatcgaggagagggattacagctac
aaggagtttgtcttcaacaccactgtgatgaccgagcacggcatcagcaacctggtggat
tcattcaccaagcagactgcaggacgggtcgctggtgggcggaacgttccgggacccatt
ttgtatgtcgccatcaagtccatcgagaacagcagaaagatgcgctaccaatccctcaat
gcttacaggaagagattcttcatggagccctactcctcgtttgaagacatgacaggagac
aaagaaatggccgccatactggaagagctgtatggtgacatcgacgctgtggagctctac
cccggcctgctcgtggagaagccccggctgaacgccatttttggggagacgatggtggag
atgggggctcctttctccctcaaaggcctgatggggaatcccatttgctcgccagagtac
tggaagcccagcacctttggaggctcagtcggctttgacatcgtcaacaccgcctccctg
cagaggctggtttgcaacaacgttcaaggcccctgtcccgtggcgtccttttatgtgcct
gacatcaaagagaccggatccatgaccatcaactcgagcacgtcgcagtcgcgtggcagt
aaccccaaccccacagtcattctgaaagaaaggacttctgagctctaa

DBGET integrated database retrieval system