KEGG   Poecilia reticulata (guppy): 103468275Help
Entry
103468275         CDS       T05149                                 

Definition
(RefSeq) low-density lipoprotein receptor-like
  KO
K12473  low-density lipoprotein receptor
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103468275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103468275
Membrane trafficking [BR:pret04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103468275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF hEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 103468275
NCBI-ProteinID: XP_008413452
LinkDB All DBs
Position
LG1
AA seq 849 aa AA seqDB search
MTGAWKGLSTCWCVLMLIHCLAQTDAAFMCSSTQFKCGNGRCVTRRWICDGNNDCGDGSD
ELEAVCSAKTCMESQFNCGAPLNQCIPKSWHCDGKADCDNAADERNCTIKECKSGEFRCT
NGQCISKAYVCDKDKDCSDGSDEEDCPKPTCHPRSFQCNNSICVPMLWKCDGDRDCLDGS
DEWPENCEGRQPLKKPSRCGAHDFECTNGECIHRTWRCDGTPDCSDQSDEFNCSQPSCHD
GQFQCGNGVCISEALKCNSANDCGDNSDEAGCQTDNVCEGPTNFKCGSGECISMDKVCDS
NGDCNDRSDEPLECGKNECSTGSNSCSHQCNDLKIGYNCSCPAGYRLKSDNRTCEDIDEC
EVPDTCSQICINLPGSYKCDCNDGYQIDPVSKTCKAESGTVATLFFTTKHEVRELTVDRS
EYTRLIPELKNAMALDLDMPNKKIFWSDLSQKKIFSSNIDMASNSANHNVVIENGIEAPE
GLVVDWIHGNIYWTDSTLKTISVATTEGNKRKTLIDERLGRPRAITIDPENNFMYWTDWG
DEPRIEKCGLNGVGRVALVTDNIEWPNGITLDMVNQRLYWVDAKLHTIFSVDVNGGARHT
VISGEENVHHPFSLTVFEEKVFWTESFRGTVSSANRLTGKYINELVTDLQNPEGLVLYHS
LKQPISINWCREGNSINGGCEHLCLPAPLLDESSPKYTCACPDNMVLAADMKKCVAAAPP
ARTDPPVMSKTTTTKPATRGTTPTSSVRTTEKPAGTAQGFQKAVMPEEAPASHPVALYVF
LPLAIIAALVCGAVLFWRNWHRKNTNTIHFANPVYQKTTEDEVHICRNGSDGFVYPERQI
VSMDDMEIA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggcgtggaagggactgtctacatgttggtgtgtgttgatgctgattcactgt
ctggctcaaacagatgcagccttcatgtgcagctccactcagtttaagtgcggaaacggg
agatgcgtcacccgcaggtggatctgtgacggaaacaacgattgtggcgatgggagtgat
gaactagaagctgtctgctcggcaaaaacgtgcatggagtcccagttcaactgcggggca
cctttgaaccagtgtataccaaagagctggcattgtgacggcaaagctgattgtgacaac
gccgctgatgagagaaactgcactataaaagaatgcaagtccggtgagtttagatgcacc
aatggtcagtgcatatccaaggcttacgtttgtgacaaagacaaggactgctctgatggc
tcagacgaggaggattgtcccaagcccacctgccaccctcggtccttccagtgcaacaat
tcaatttgcgtgccaatgctgtggaaatgtgacggagacagggactgtctggacgggtct
gacgagtggccggagaactgcgaggggaggcagccgttgaagaagccgtcgcgatgtggc
gcccatgattttgagtgcacaaacggtgaatgtattcataggacttggaggtgtgatgga
actcctgactgctcagaccagtcggatgaattcaactgcagtcagcccagctgtcatgac
ggtcaattccagtgtgggaacggtgtctgtatcagtgaagccctgaagtgtaactctgcg
aacgactgtggggacaacagtgatgaagctggctgtcaaacagataatgtgtgtgaaggt
ccaaccaacttcaagtgtggcagcggggagtgcatcagcatggacaaagtatgtgactca
aacggagactgcaacgaccggtctgacgaacctcttgagtgtggcaaaaacgagtgttca
acaggaagtaacagttgttctcatcaatgcaatgacctgaagatcggctacaactgctcc
tgcccggctggatacagactgaagagtgacaatcgaacatgtgaagacattgatgaatgt
gaagtgccagacacctgcagtcagatctgcatcaacctgcctggaagctacaagtgtgac
tgcaacgacggctatcaaattgatccagtgagcaaaacgtgcaaagctgaatcagggaca
gtggccacgctgttcttcaccacaaagcacgaggtcagggagctcacagtggaccgcagt
gagtataccaggctgatcccagagctgaaaaacgctatggctctggatctggacatgccg
aacaagaagatcttctggtcggacctctctcagaagaaaatctttagctcaaacattgac
atggccagcaactctgctaatcacaacgttgtgattgaaaacgggattgaagccccagaa
ggccttgttgtggattggatccatggcaacatctactggactgacagcaccttgaagacc
atctctgtggcaactacagaaggcaacaaaaggaagaccctcatcgatgagagacttggg
aggcccagagccatcacaattgacccggaaaataactttatgtactggactgactgggga
gatgagcctaggattgagaagtgtggactcaacggagtcggtcgtgtcgccttggtgact
gataacattgaatggcccaatggcatcacccttgatatggtaaaccagcgtctgtactgg
gtggatgccaagcttcatactatcttcagtgttgatgttaacggaggggccagacacacg
gtcatatctggtgaagaaaatgtccatcatcccttctcactgactgtctttgaggagaaa
gttttttggacagagtccttccgtggcacagtttccagtgctaaccgcctgacaggaaag
tacatcaatgaattggtgactgacctgcaaaatccagagggccttgttctttaccacagc
ctgaagcagccaatcagcattaactggtgcagagaaggcaacagcataaatggaggctgt
gagcacctgtgccttcctgctcctctgcttgacgagagctctcctaaatacacctgcgcc
tgtccagacaacatggtcctggccgctgacatgaagaaatgtgtggcagctgcacctcct
gccaggactgacccacctgtcatgtccaagacgaccaccactaaaccagctacacgtggc
accacacctacctcatctgtccggaccacagagaaacctgctggcactgctcaaggcttc
caaaaagccgtgatgcctgaggaagctcctgcatctcatcctgttgctctctacgttttt
ctaccactcgcgatcatagcggcactggtgtgtggagcggtgttgttttggagaaactgg
cacaggaagaacaccaacaccatccacttcgccaatcccgtgtaccagaaaaccaccgag
gacgaggtgcacatctgcaggaacggctccgacggcttcgtctatcccgagaggcaaatt
gtgagcatggatgacatggaaattgcatga

DBGET integrated database retrieval system