KEGG   Poecilia reticulata (guppy): 103468503
Entry
103468503         CDS       T05149                                 

Gene name
lepr
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04060  Cytokine-cytokine receptor interaction
pret04080  Neuroactive ligand-receptor interaction
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103468503 (lepr)
   04060 Cytokine-cytokine receptor interaction
    103468503 (lepr)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103468503 (lepr)
Cytokine receptors [BR:pret04050]
 Interleukin receptor families
  Prolactin receptor family
   103468503 (lepr)
CD molecules [BR:pret04090]
 Proteins
  103468503 (lepr)
SSDB
Motif
Pfam: ObR_Ig fn3 Lep_receptor_Ig Ig_3
Other DBs
NCBI-GeneID: 103468503
NCBI-ProteinID: XP_017161584
LinkDB
Position
LG8
AA seq 1137 aa
MTVQCLRPGAPVXPGALDVPWQDELCCDSPTAYTYIEEGTSQSDLNXPQSPSCKFRSSSA
ESKPPGGTCLDVLCRFDESWSNLTCDLKSSGLSSGLMKPIRTAVSLQKISPENDTDHHAS
EHQVVCDAEDSLMCSIHLNSTRISAVWLTVNVSNVLAPPVLLRISPRSVKPSPPFNLSHS
QTVEGDLILSWKEPLDFSDNLLAYEIRYSHENTNKNTHKNWQVVSALEKPNVSLDLKPLL
KYTIQVRCTTQTQPELWSDWSDPYYITLNKVSYIPQKVVARAGDNVTVYCVLNGQSANAN
TAMWSLNRREPLDPSLYHPVNQRVSQITFTASETGLSDLLTCTQEWNIPYSKIYVEGGFI
SITCVTNGDIDTMTCRWENKEWEIVKLRSKSAEMSCDEMEERVRGGEDVGEMGHECMPIK
TTEKFCTFHPLKMNCYKLWLELHTRLGVIRCKPVYVSPINHVKPYPPTDVTAVSRSSGIL
RVSWKPPSLPVEGLQCQFRYYLLGVLEKWKFEKPVWVPWAEVEVPDMCQIYVVQVRCMHT
SGIGYWSEWSDHSIKACQEQTPERGPDFWRIRQDEPDRNQSNITLLFESFSANWNTYCXD
GFIVQHQASNGSVLRRQIDMVSSYSFEWNQELHIVTVEAYNSLGSSVNNVNMTLEKQPKR
RCLHSFHVLVMNSTCVSLSWSLLHISSVPLFMVVQWFPRKQQDFEDFGLSKRTWAKLSYT
EPPTQLRGDFFSSEEYAFHLYPVFADGEGEPVVTIVKTGNPPAYMMLMFISLLCIAVFVT
LVLSQNQMKKFVWKDVPNPNRCSWAKGLDFKTMDGFEYLFRPPEGLQAXPLAPEKISKVT
VVNKTLTKAFVQTPTLLAPPSVVASTNSFLPCLDPRTGQLLECEMALGSDTSPDPLTTSD
IIINELQPVNALVEQSSGTTNSSTQSAVTYSKVLHTDTNPDHPPLHLHYKEGSRSSYSDE
GNFSANNSDTSETFPGGLWEVDSYHGTESDDPRRSYSYNSEKELSEASEQEDDIDVGQKK
ALHYLBIGHPPEDEENEEEESQTELLKSAHLIREDCSVELYPLLSPDESTDPKTLVQVST
CSFASLYMPQYRKPDVNHIPHTSPATRGQKSVTSRVCKRHFNDVRGKRCFQALSCLP
NT seq 3414 nt   +upstreamnt  +downstreamnt
atgactgttcagtgtttgcgacctggagctcccgttyatccaggcgccctggacgtcccc
tggcaggatgagctgtgctgtgactcacctactgcttacacttatatagaagaagggacg
agccagtctgatctaaacytcccacagtctccaagctgcaaatttaggagctcctcagct
gaatcaaaacctccaggcggcacctgtttggacgttctgtgcagatttgatgaatcctgg
tcaaatttaacttgtgatcttaagtccagtggcctgtcatctggtttaatgaaacccatt
cgtacggctgtcagcctccagaagatctctccggaaaacgacacagatcaccatgcgtct
gaacatcaggttgtgtgtgatgcagaggattcacttatgtgctcaattcatctcaattca
acaagaatctctgccgtttggctaacggtcaacgtctccaatgttttggctccaccggtt
ttgctgagaatttctcccagatctgtgaaaccaagtcctccattcaacctgtcacactct
cagactgtggagggagatcttattctcagctggaaagagccattagactttagtgataat
ttgttggcctatgaaatccgatattcccacgaaaataccaacaagaacacccataaaaac
tggcaggtggtgtctgcacttgaaaagcccaatgtgtcactggatttgaaacccttactg
aagtacaccatccaggttcgctgcaccacgcaaactcagcctgagctgtggagcgactgg
agcgacccctactatatcaccctgaacaaggtgagctacatccctcaaaaggtagtggca
cgagccggtgataatgtaacggtttattgtgtgctaaacggccagagcgccaacgcaaat
acggccatgtggtccctcaaccgaagggagccgcttgatcccagtttgtatcatcctgtc
aaccagcgggtcagccagatcacattcacagcttcagagactgggttgtctgacctgctg
acctgcacacaggagtggaatattccttatagcaagatctatgtggaaggaggattcatc
agcatyacgtgtgtaaccaacggtgacattgacactatgacctgcagatgggagaataaa
gagtgggaaatagtcaaattgcggtccaagagtgcygagatgtcatgtgacgagatggag
gaaagggtgagaggtggcgaggacgttggtgagatgggacatgaatgcatgccaatcaaa
actacagagaaattctgcacgttccaccctttgaagatgaattgctacaaactgtggctt
gaattgcatacccgcctaggtgtcatcaggtgcaaacctgtctatgtgtcacccataaat
catgtaaaaccttaccctcccactgatgtgacggcggtgagccggagcagtgggatcctg
agggtatcttggaaaccgccttctctgccggtcgaaggcctgcagtgtcagtttcgktac
tacttactcggtgttttagagaaatggaagtttgagaagcctgtgtgggttccctgggcc
gaggttgaggtaccagacatgtgccagatctacgtggttcaagtacgctgcatgcacacc
agtgggatcggatactggagtgaatggagtgaccactcaatcaaggcttgtcaagagcaa
actcctgaacgtgggcctgatttctggagaatacgtcaagatgagccagacagaaaccag
tccaacatcactctgctgtttgagtctttctcagcaaactggaatacctactgtktggat
ggatttattgtccagcaccaggcgtcgaatggatctgtgctgaggaggcagatcgatatg
gtgtcctcctacagctttgagtggaaccaggagctccacattgtgactgtggaagcctac
aatagtctggggagctctgttaacaacgtcaacatgacgctggagaaacaacctaaacgc
cgctgtctccattcattccacgttttggttatgaacagcacttgtgtatccctgtcctgg
agcctgttgcatatcagctctgtccctctcttcatggtggttcagtggttcccaaggaag
cagcaggactttgaagactttggtctaagtaaaagaacgtgggccaaactgtcctacacc
gaacctcctacccagttacgaggagatttctttagctcagaggagtacgccttccacttg
taccccgtgtttgctgatggagaaggagaaccagttgttacaatagttaagacaggaaat
cctccagcttacatgatgctgatgttcatctccctcctttgcattgccgtgtttgtgacc
ctggttctctcccaaaaccagatgaaaaaatttgtgtggaaagatgttccaaacccgaac
aggtgctcatgggcaaaaggactagactttaaaacgatggacggctttgagtacctgttc
cgacctccggagggtcttcaagccwctccgctggcccctgagaagatctcaaaagttact
gttgtgaataaaactctgacaaaggcctttgtccaaacaccaacactcttggctcctccc
tctgttgttgcttcaactaactccttcctgccttgtttggacccaaggactggccagttg
ctggagtgtgaaatggcccttggtagcgacactagtccagatcccttaactacttcagac
ataatcataaatgagctacaaccagtcaatgccttggtggagcagagttcaggaaccact
aacagctcaacccagtctgckgtcacatactccaaggtcctgcacactgatacaaatcca
gatcatccacctcttcatctccactacaaggagggaagtaggagcagctacagtgatgag
ggaaacttctcagccaacaactcagatacctctgaaactttccctggtggactgtgggaa
gtcgacagctatcatggtacagaatcggatgacccaaggcgatcctactcctacaactct
gaaaaagagctttctgaagcatcagagcaagaagacgacatagatgtgggtcaaaagaag
gccttgcactatctcracatyggacatccwccagaggaygaggaaaatgaggaggaggag
tcacagactgagcttctgaaaagcgcacatttgatcagagaggactgttccgtagagttg
tatcctttgctcagcccagatgagtcgacggatcccaagacgctggtgcaagtgtcgact
tgtagttttgcctctctgtacatgcctcagtataggaagcctgacgtaaatcacatcccg
cacacatctccagccacaagggggcagaaaagcgtcaccagccgagtttgtaagcgtcat
ttcaatgatgtcaggggaaaacggtgcttccaggctctgtcttgtttgccatag

DBGET integrated database retrieval system