KEGG   Poecilia reticulata (guppy): 103468756
Entry
103468756         CDS       T05149                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103468756 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103468756 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    103468756 (lpar2)
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103468756 (lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 103468756
NCBI-ProteinID: XP_008414265
LinkDB
Position
LG8
AA seq 367 aa
MTIDNITSDSCYSNQSVTFFYQHADKAIGGNWTTRDYLVLGLGLPLSFIVVLANLLVMAA
ILMNRRFHFPIYYLLGNMAAADLFAGLAYTNLILNTGPWTAXLTKKQWYIRGALIDISLT
ASVANLLAVAVERHQTVITMQLHSTMTKRRVVLLIISIWAVGIVMGLVPSLFWNCECDLX
DCSTVAPLYSRRFLIFWALLNLLTFFVMLGMYSHIFFHVKRQGRHTSQHVSEARQQTVIN
LMKTISMVLGAFVICWTPGLIVLLLDGLQGKNGNANKYEKYCLVIAECNSLVNPIIYSLR
DGEMRKTFKWILCCFCRHGGCQPRETLSTEMDSPLKEKSLIYKLEDSVLWKNPDRDSKDG
KWTDSVV
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaccattgacaacattacgtcggacagctgctacagcaaccaaagcgtcacyttcttc
taccaacatgcggataaagcgatcggaggaaactggactacacgggactacctggtccta
ggactaggcttgcccttatctttcatagtggtgttggccaacctgttggtgatggcagcc
atcctcatgaaccgccgcttccacttccccatttactacctgctgggaaacatggcagca
gcagacttgtttgcgggtttggcctataccaacctgatactcaacacgggaccctggaca
gcgaygctcaccaagaagcagtggtacatccgyggggctttgattgacatcagcctgact
gcctccgtcgccaacctcctggctgtggctgtggaacgccaccagaccgtcatcactatg
cagctgcacagcaccatgaccaagaggcgcgtggtgctgctcatcatctccatctgggcc
gtagggatcgtcatgggtctggtgccgtcgctgttttggaactgcgaatgcgatctcrcg
gactgctccactgtcgcgcccctctacagccgccgcttcttgattttctgggcacttctc
aacctgctcacctttttcgttatgctgggcatgtactctcacatattctttcacgtgaaa
cgccagggtcgccacacttctcaacacgtctcggaggcacggcagcagacmgtcatcaac
ctgatgaaaaccatttctatggtgctgggcgccttcgtgatctgctggacacctggcctc
atcgttctcctcctggacgggctgcagggtaaaaatggcaacgccaacaagtacgagaaa
tactgtttggtgatagcggagtgcaactctctggtcaatccgatcatttattccttacgc
gacggcgagatgcggaaaacgttcaagtggatcctttgctgcttctgtcgacatggaggc
tgtcagccgagggagactctgtcgacagaaatggactctccattgaaagagaaatctctt
atctacaagttggaagattcagtcttgtggaagaatccggacagagacagtaaagatggc
aagtggacagactctgtggtatga

DBGET integrated database retrieval system