KEGG   Poecilia reticulata (guppy): 103468964Help
Entry
103468964         CDS       T05149                                 

Definition
(RefSeq) uncharacterized protein LOC103468964
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103468964
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pret03036]
    103468964
Enzymes [BR:pret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103468964
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103468964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF1997
Motif
Other DBs
NCBI-GeneID: 103468964
NCBI-ProteinID: XP_008414608
UniProt: A0A3P9P240
LinkDB All DBs
Position
LG8
AA seq 1834 aa AA seqDB search
MDGYTRMSVKELCETDDLATSLVLDPLLGFSTHKMNISPAPEIRRWGVLKETLLRFQRTH
DFNATFEALTVGELAGDYFNALGSHRQELLRQHVYRYLSAFLLDSGIKIESCDRYSSETN
GAKITATRHWFVGERVEVLLGCIAELNPADSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFLPGEKNIACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFRHRGKQPDSEEAKEAVGQKYRLRERYLRHHRERGHLTPRPSAPAIHAGIFTAIPSRN
SFTQQMRRNALKNKKLNDTKRWRREKQRRSGNHLLKSCRTVPLPFQVALRDLRIRVRRHS
VDFLLHCKDPKSKERELLQELEEVKPRKATVEENPKSLTLNSSVPTNPRSRSAVNSVALN
MKICSRAKSVVHKTQETKTESSSTNTTNTITACPPVERDKTCSAVKQKNMEKSITESQSS
KVESRVAAPPLTVSEKAADNPVITLKQYVTVDLTRLSIPQPTEAGKTQEEEKGGVLGRGR
SQPPPKPGNLPRKQVSRSDVCKATSKRGGRETLLKATDGTDVHKEVAGNPSGCEKKGVDR
VVEIKTVQTELQEEKRDPKSTEAEKVGKLKAGSNIQSVKNAEKVEVKVSGQTKRCLNERP
EDVVIKQAKVLLSDILRKDKSFLDQRLQGDINRGSCNPSIKGRLLKKRSVRKAKLDESQN
GTGTPNDERLVSICTDLGVKSSQVQSEPKRSELPASSSINSLPHRSAVSTKAQPNPDTNP
QSNIPLKKRTFRSSVEIDSQRGPTSASDRVPKNTAVVTSPPAPQPNTSATSGEAKKDNKS
APRRIQKQPVVSRVLRSRPNGSPRGHLLRKVRQCKQENQEEDICEDMSDSPEAVTRRSLK
NSPNNLESSSPEENSSEETKAGFDFKIRLKRRRGKVWDVQGESLALKTEKHDDSMACDPF
KAIMDSVSILNREMEAHVQASQKAKSRLHRLRQRNDKNNIKQVTDVQTDGVSETKVGQNE
SVDKKSEIKAKLESRSMLSLNGTSETIPETKVEDRFLKSCCLFESTSQQKLEPELGSNGL
QLPVLKLRRKVEDIWEVDSKKGLDLPDLMAEVKREVKNHALGRQKKEETCLRLNSNLMSL
KTEPPRFSLSLSPLSLSSPLNEGKTEAAHSAGERIIERLESYMGGRKQRLKVDKQRKSVP
METPTPCLSHTLQQIDNSLSRLSEGLCSSQTLEKPTAACASASGSVIQTPSQSPPFVAAD
NMLSAEPSFTNCCEDILDFQCLGFEGYDQPQNILPSSPSDLCSLDPPTDPFSSPLSHSPT
DTWSTETPYLGPPSPGNNFTSEDLQFFPGLVASKSDSGNVQNCEAKGISKDGSNSGFGFP
APINSDVVSKERIMSKNLGARSSKDDPRTQSSLSVASKSRTFTGNPIVLSQPSLNFKATT
SQSKTELHLKTQGPFHRMTIPSKSQSFPSNQPTVVRGTPAQVSNRFLSPSVLSTKNPNSP
ESPFSCQEKPSTVIHRVLKYQGGSQTQNLYSAPCEDTVAASGGARLSAKQNEKFVPNVSQ
KSNVSFQGFGKDVGHLSSSNNLARSNLHFSRPNSSISQSFSKNKMASDKQEAAETNMGYK
NFSEMPRPFFFPSKASDCYSSQQDKKLDKTDKHQPCYTQQDAYDFSYSSLSPISQHSSPQ
LVHSTPPGTPAPKTQSTASFPYGYQGPPYVLNFSGDHSLTLGLRDGSDGYPGLGPTNYTY
HCLMEPSGTQGRLVLEPCGPQLSNPSSLGGFAGLRSQDEHCRKDMQQQCQPGENQGASHY
GGVPTSHPMGVTKPKRVRLVVTDGTVDLDLQYSD
NT seq 5505 nt NT seq  +upstreamnt  +downstreamnt
atggacggctacactagaatgagtgtgaaggagttgtgtgagaccgatgacctggccacc
agtttggtgctggaccctcttctgggcttcagcacccataaaatgaacatcagtccggca
ccagagatcagacgttggggtgttctcaaggagacgctgctgcggtttcagcgaacacat
gacttcaacgccacgtttgaggcgctgacggtcggtgagctcgctggcgactacttcaac
gctctggggagccaccggcaggagctgctgagacaacatgtgtatcgctacctcagtgcc
ttcctgctggacagtgggatcaagatagagtcgtgtgacagatactcatcggagaccaac
ggggcgaagataacggccacgaggcattggttcgttggagagcgcgtggaggtcctactg
ggctgcatagcggagctgaaccccgcggacagcgccgtgttgagggctggggtcaacgac
ttcagcgtcatgtactccacacgcaaacgctgcgctcagctgtggctcgggcccgcagcc
ttcatcaaccacgactgcaaaccgaactgcaagtttctccccggtgagaagaacatcgcc
tgtgtggaagtgatccgacccatctcgcctggggaggaaatcacctgttactatggcgcc
agcttcttcggcgaaggcaacgaaatgtgcgaatgctgcacctgcgagaggaacggagag
ggccacttcaggcacagagggaagcagccggacagcgaggaggcgaaggaggccgtgggc
cagaagtaccggctgcgggagcgatacctgcgccaccacagggagagaggacacctcacc
cccaggcccagcgcgccggcgatccacgccgggatcttcacagcgatcccctccaggaac
tccttcacccagcagatgaggagaaacgctctgaagaacaagaagctgaacgacaccaag
aggtggaggcgtgagaagcagaggcggtcggggaaccacctgctgaaaagctgccggacc
gtcccgctgccgttccaggtcgctctgagggacctgcgcatcagagtgcggcgccactcg
gtggatttcctgctgcactgcaaggatcccaaaagcaaagagagggagttgctgcaggaa
ctagaggaggtgaagccaagaaaagcgactgtcgaggaaaacccaaagtctttgactttg
aattcctccgtgccaaccaatccgagaagcagatcggccgtgaacagcgtcgctttgaac
atgaagatctgctcaagagccaaaagcgtggttcataaaacgcaggagacaaagacggag
tccagtagcacaaacacaactaacactattacagcttgtccgcctgttgaaagggacaaa
acctgcagcgcagtaaagcagaagaacatggaaaagtctatcactgaaagtcaaagcagc
aaagttgaatccagggtcgccgctccgcctctgaccgtgtcggagaaggctgctgacaat
ccagtaatcactctgaagcaatacgtcaccgtcgaccttaccaggttatcaatcccgcaa
cccacagaggccggaaaaacacaagaagaggagaaaggtggcgttttagggagaggaagg
agccaaccgccccccaaacctgggaacctgccaagaaagcaggtttccaggtcagacgtc
tgcaaggctacgagcaaacgaggagggagggaaacgctcctcaaggccacagatggaaca
gatgttcacaaagaagtcgccgggaatccatctggctgcgagaagaagggggttgacaga
gttgtggaaataaaaacggtgcaaacggagctgcaggaagagaagagagaccctaaatca
actgaagctgagaaagtggggaagttgaaagcagggagtaatatccaaagtgttaaaaat
gcagagaaagtggaagttaaagtgtcaggacagacgaagagatgcttgaatgagcgtccc
gaagatgtggtgataaaacaggcaaaggttttgctgtcggacattttaagaaaagataaa
tcttttttagatcagaggctgcagggagacataaacagagggagttgcaatccttccatt
aaggggaggcttttgaaaaaacgcagtgtgcggaaagctaaattagatgaatcacagaat
gggacgggaaccccaaacgacgagcgattggtttctatttgcacagacttgggtgtgaaa
agttcacaggtccagtcggaaccaaagcgcagcgaactgccggcctcctcctccatcaac
tcactacctcacaggtcggccgtttctacgaaggctcagccgaacccggacaccaacccg
cagtccaacatacctctgaagaaacgcacatttcggagctccgtggagatcgactcgcag
cgaggtccgacttccgcctccgatcgtgtcccgaaaaacacggccgtggtgacgtcgcct
ccagcaccacaaccgaacacgtccgctacctctggagaagccaagaaagacaataaatca
gctccaaggcggatccaaaaacaaccggtagtttccagagtgcttcgctccagacctaat
ggatctccacgaggccacctgctgaggaaagtccgacaatgcaaacaagaaaatcaggag
gaggatatttgtgaagatatgagtgatagtcctgaggctgtcacacgtagatccctaaaa
aactccccgaataacctggaatcatcgtcccctgaagaaaacagttcagaggaaacaaaa
gccggctttgatttcaagatccgcctcaagcggagaagaggaaaagtgtgggacgttcag
ggcgagagcttggcgctgaaaacggaaaagcatgacgactcaatggcatgcgatcctttc
aaagcaatcatggactctgtgtccatcttaaaccgagagatggaggctcacgttcaagcg
agtcagaaggcgaagagcagactgcatcgattgagacaaagaaacgacaaaaacaacata
aaacaagttactgacgtccagacggatggagttagtgaaactaaagtcggacaaaacgaa
tctgttgacaaaaaaagtgaaattaaagcaaagttggaaagccggtccatgttgagcctg
aatggaaccagtgagacgattccagaaactaaagtggaggatcgttttttaaaaagctgc
tgtctgtttgagagcacgtcccaacaaaagctggagccagaactgggttcaaacgggctt
cagctgccagttctgaaactgcggaggaaggtggaggatatctgggaggtggacagcaaa
aaggggcttgacctgcctgacctaatggccgaggtcaagagagaggtcaagaatcacgcc
ttagggaggcagaagaaagaggagacttgtctgagactcaacagcaatctgatgtctcta
aaaacagaaccaccccggttttccctctctctttcgccgttgtcgctgtcatcgcctctt
aacgagggcaaaaccgaagctgcacactcggccggagagcgaatcatagaaaggttggag
tcgtacatgggggggaggaaacagaggctcaaagttgacaaacagcgcaagagtgtgccc
atggagacgcccaccccttgtctgagtcatacactccagcagatagacaacagcctctcc
aggctctccgaaggcctgtgttcctctcagacgctggagaagcccacggcggcttgcgcc
agcgcctccggttctgtgatccagaccccgtcccaatcccccccgtttgtggccgctgac
aatatgctgtccgccgagcccagcttcaccaactgctgtgaagacatcctggacttccag
tgcctcggctttgagggatacgaccagccgcagaacattctcccatcctccccatcagat
ctgtgctccctggacccgcccaccgacccatttagcagtcctctctcccacagcccgacc
gacacctggtccactgaaacaccctacctgggcccgccaagtccggggaataacttcacc
agtgaggatctgcagtttttcccgggcttggttgcttccaaaagtgactccgggaatgtt
cagaactgtgaagccaagggcatctccaaagatggatccaactccggttttgggtttcca
gctccgataaattcagacgttgtgagcaaggagcgtattatgagcaaaaatctgggagcg
aggagctccaaagacgaccccagaactcaatcatctttgtccgtcgccagcaagtctcgt
actttcaccggaaatcccattgttttaagccagccttccctcaacttcaaggccaccacc
agccaatcaaaaacggagctccacctcaaaacccaaggcccgttccatcgcatgaccatt
ccaagtaaatcccagtcattcccaagtaaccagccaactgtggtcagaggaacaccggct
caagtgtccaacagattcctttccccttcagtcctttctacaaagaatcccaactctcct
gaaagtccattcagttgccaggagaagccatctactgtaatccacagggttctgaagtac
cagggtggtagccagacgcagaacctgtacagtgcgccgtgcgaagacaccgtagctgct
agtggcggcgcccggctctctgccaaacagaatgagaaatttgttcctaatgtgtctcaa
aaaagcaacgtatctttccaggggttcggaaaggatgtcggccatctcagttcctccaac
aacctcgccaggtccaaccttcacttcagcagacccaattcctccatttcacagtctttc
agtaaaaacaagatggcatcagacaaacaggaagcggctgaaactaacatggggtacaaa
aacttttccgagatgccgagacccttcttctttcctagcaaagcatccgactgctactca
tcccagcaagacaagaagctggacaaaaccgacaaacaccagccatgttacacacagcag
gatgcttatgactttagctattcctctctctcacccatctctcagcacagcagccctcag
ctagtccacagcacacctccaggtacaccagcacccaaaacccagtctaccgcctccttc
ccttacggctaccaaggtcctccctatgtgctgaacttcagcggcgaccactcgctcact
ctgggcctgagggatggttctgatggctacccgggcctgggccctacaaactacacctac
cactgcctgatggagccctcgggcactcaaggacggttggtccttgaaccttgtggaccc
caactgtccaacccgtcctctctgggcgggttcgctggcctcagaagtcaggatgaacac
tgccggaaggacatgcagcagcagtgccagccaggggaaaaccaaggtgcttcgcactac
ggtggggttcctacgtcgcacccaatgggcgtcacaaaacccaaacgcgtgcggctggtg
gtgacggacggtacggtggacttagacttgcagtactcagactga

DBGET integrated database retrieval system