KEGG   Poecilia reticulata (guppy): 103469092Help
Entry
103469092         CDS       T05149                                 

Gene name
gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04910  Insulin signaling pathway
Module
pret_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103469092 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103469092 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pret01003]
    103469092 (gys1)
Enzymes [BR:pret01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103469092 (gys1)
Glycosyltransferases [BR:pret01003]
 Polysaccharide
  Storage polysaccharide
   103469092 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 103469092
NCBI-ProteinID: XP_008414806
LinkDB All DBs
Position
LG8
AA seq 709 aa AA seqDB search
MPLARSLSVTSLSGLDEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARMTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNASGCKIYFGRWLIEGSPYVVLIDVA
FTAWSLDRWKSELWDLCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQSEDPPHIVAQFH
EWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCLERAAAHCAHVFTTVSQITAIEAEFLLKRKPDIITPNGLNVKKFSAMHEFQNLHAQS
KNRIQEFVRGHFYGNLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKML
DKEDFTIMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYIAARHMALAKAFPDTYVYDPQEPSSASGFRYPRPASVPPSPALSRHSSPHHSEAE
DNDEDERYDEELEAEKDRVNIRQPYTIPVKGKAVLGGNGSGEDEASEKN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccactggctcgcagcctgtctgtcacgtccctatcaggacttgacgagtgggacgag
gagtttgatttggaggatgctgtactttttgaaattgcatgggaggtagccaacaaagtt
ggagggatttacacagtcatacagaccaaagcccgtatgactgcggaggaatggggggag
aactatttcctggtgggtccctacgtggagagcaacgtgcgcacccaagtggagctgatc
gagccaaccaatcctgtgctgaagcggaccattgataaaatgaacgccagtggctgtaag
atttactttggccggtggcttattgaaggcagtccatacgtcgttctgattgatgtcgcc
ttcaccgcctggtctctggaccgctggaagagcgagctgtgggacctctgtgccatcggc
gtgccttggttcgaccgcgaggccaacgatgccgttctgtttggcttcctcaccgcctgg
ctcttgggagagtatgcggctcagtctgaggatcctccacacattgtagcccagttccat
gagtggctggcaggtctgggcctggtgctgtgcagacaaagacagcttcctgttgcaact
attttcaccacccatgctacgctgctgggtcgctacctgtgtgccggaaatgtggacttc
tacaacaacctggcagagttcaatgtggataaagaagccggagatcggcaaatttaccat
cgctactgtctggagcgggcagctgcacactgcgctcacgtcttcaccactgtgtcacaa
attacggccatcgaggccgagttcctgctcaagaggaaacccgacatcatcactccaaat
ggcctcaatgtgaagaagttctctgctatgcatgagtttcaaaacctccatgctcagagc
aagaatcgtattcaggagtttgtcaggggtcacttctatgggaaccttgacttcaacctg
gacaagtgtctgttcctcttcatagcaggaaggtatgaattctccaacaaaggagccgac
atcttcctcgaggctttagccagactcaactatctactgagagttaaccacagcgatgtg
accgttatagctttcttcatcatgccagctcggaccaacaactttaacgtggagacgctg
aagggccaagcagtgcgaaagcagctatgggatacagcccagactgtgaaggagcgcttt
ggaaagaaactttatgaatcactcctagttggtcagctgccagatgtgtcgaagatgctg
gacaaagaagacttcaccatcatgaagcgtgccatctttgcgactcagaggcagtgccag
cctccagtctgcacccacaacatgctggaggacagcagcgaccccatccttaactgcgtc
cgccgcatcggccttttcaacagctctgctgaccgagtcaagatcatcttccacccagag
ttcctttcatccacgtctcctctgcttcccatggattacgaggagtttgtcagaggctgc
caccttggtgtcttcccttcttactatgagccttggggttatacaccagctgagtgcaca
gtgatgggtattccatccatatccactaatctgtcaggcttcgggtgtttcatggaggaa
cacatagcagacccttcagcgtacggtatttacatccttgaccggcgctacaagggtgtc
gacgagtcgtgcaaccagctcacttccttccttttccagttctgcaaacagagccgacgc
cagcggatcatccagaggaatcgcacagagcgcctgagtgacctcctggactggagatac
ctcggcagatattatatagctgctcgtcatatggccttggctaaagccttcccagacacc
tatgtatatgaccctcaggagccctcctcggcttcaggtttccgctacccccgaccagcc
tctgtgcctccatctccggctctgtcccgtcactcctccccgcaccacagcgaggccgaa
gacaacgacgaggacgagcgttacgacgaggagcttgaggccgaaaaggaccgcgtgaac
atccgccagccctataccataccggttaaaggcaaagccgtcctcggaggcaacgggagc
ggcgaggacgaggcgagcgagaaaaactga

DBGET integrated database retrieval system