KEGG   Poecilia reticulata (guppy): 103469228Help
Entry
103469228         CDS       T05149                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret01100  Metabolic pathways
pret04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103469228 (gaa)
   00500 Starch and sucrose metabolism
    103469228 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103469228 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103469228 (gaa)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103469228 (gaa)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103469228 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 103469228
NCBI-ProteinID: XP_008415003
LinkDB All DBs
Position
LG8
AA seq 932 aa AA seqDB search
MGILSTTVLLLSLSLLACLHRELLFSKEGRLVRSDNFDHYEVVLRKKPGYSYPXEPKSIS
KSDIHPDILQRSGNSRETECTAAPESRFDCGRDRLLSQEECEDRGCCYAPLPGSAGPPWC
FYPAQYPGYNMGPLTPSEKGQTATLTRASPSYLPKDISTLSLEVIAETASCFHVVLKDPS
SQRYEVPLPAGSFQTEAYTQDVLYTTEFLHNPFGFIVRRKSNGRVLMNTTVAPLLFADQY
LQLSTSLASSLVSGLGEHYTSLVLDLNWTSWTLWNRDMAPHADANLYGSHPFYIVQEDDG
LAHGVFLLNSNAIEVILQPTPALTWVSTGGILDLYIFLGPDPQSVIRQYLQVIGFPMMPP
YWSLGFHLCRWGYTTTNATRMVAQRMHSANFPMDVQWNDLDYADKRXVFTFDPVRFGDLP
EMVQEFHKKGMKYILILDPGISSTSPPGTYPPFENGVKRDVFIRNATGDILIGKVWPGPT
AFPDFTNPEARQWWEDCIRDFFSKVPVDGLWIDMNEPSSFVQGSVVGCPDSELEKPPYTP
RVVGGQLNSGTICMSAQQQLSSHYNLHNLYGLTEAYATHSALMNIQGKRPFVLSRSSFPG
IGRFSGVWTGDVRSDWEQLRFSIPAVLQFSLLGVPLVGADICGFEGNTNEELCVRWMQLG
AFYPFMRNHNDKPNAPQEPFVFGQKAQAAMRSALNLRYSLLPFLYTLFHRAHTSADTVAR
PLFMEFPTDPHCQTIDQQFLWGSSLLISPVLEQGAVELSAYLPAGTWYQLDNGQPFHSNG
QYVQLSAPLETINVHVREGHIIPQQEPALTTAXSRENRFFLTVALSSGGWARGELFWDDG
DSLRTFETQNYCYVNFTAGQSQIISDPLNLNGALASLRLGGLQVFGVPSQPLYVLANGEK
VIDFTYKTDTKVLTVTRLALPMSKTFTVQWVL
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgggtattttgtcaaccacagtgctcctcctttctctgtctttgttagcgtgtttacac
agggagcttttgttcagcaaagaaggcagactcgttaggtcagataattttgatcattat
gaagtcgtgctacgtaaaaagcctggttattcttatcccaragaaccaaagagcatttca
aagagtgacatccacccagatattctccaaagatctggaaattccagagaaactgaatgc
accgcagctccagagagtcggtttgactgtggcagggacaggttgttgagccaagaggag
tgtgaggacagagggtgctgctatgctcctctacctggatctgcaggaccaccctggtgc
ttctaccctgcccagtacccaggctataacatgggacccctcacccccagtgagaagggt
cagactgcaaccctgacccgggccagcccttcctatctccccaaagatatctccactctg
agcctggaagtcatagcggaaactgcaagctgctttcacgttgttttaaaggatccatcc
tctcagcgatatgaagtccccctcccagctggtagctttcagacagaagcatatacccag
gacgttctctacacaaccgaattcctgcacaatccttttggtttcatagtgcgacgcaag
tccaatggaagggttcttatgaacaccacagttgctcccttgctgtttgctgaccagtac
ctgcagctgtccacctctctggcctcctccttggtgtccggtcttggagaacattacacc
tctctcgtcctggacctcaactggacatcatggactctttggaacagagacatggcaccg
catgctgacgctaacctctacggctcccatccattctacatagtgcaggaagacgacggc
ttagcacatggagtttttcttctcaacagcaatgcaatcgaagtgatactacagccaaca
ccagctctcacatgggtatccactggtggaatcctggatctgtacattttcttgggtcct
gaccctcaaagtgtgatacgacaatacctgcaggtcattgggtttcccatgatgcctcct
tattggtctctgggctttcatctttgtcgctggggttacacaactactaatgcaacccgc
atggttgcacaacgcatgcatagtgcaaactttcctatggatgtgcagtggaatgacctg
gactatgcagacaagcgaakggtgttcacctttgaccctgtgcgatttggggatcttcca
gagatggtccaggagtttcataagaaaggcatgaagtacatcctcattctggatccgggc
attagcagcaccagcccccctggaacatacccgccttttgaaaatggtgtgaaacgagat
gtgtttattaggaatgcaactggagacattctgataggcaaggtttggcccggcccaaca
gcatttcctgacttcaccaaccccgaggccaggcagtggtgggaggactgcatcagagac
ttcttctctaaagttcctgtagatggtctgtggattgatatgaatgaaccgtccagtttt
gtccagggatcagtggtgggctgccctgacagcgagctygagaaaccaccatacacacct
agggtggttggaggccaattgaactcgggaaccatatgcatgtcggcacagcagcagctg
tccagtcattacaacctgcacaatctgtacggattgactgaagcttatgcaacgcacagc
gctctcatgaacattcaggggaagagaccctttgttttgtctcgctcctcgttccctggc
atcgggcggttttctggagtgtggacaggagatgtgaggagtgactgggagcaacttcgg
ttctccatccctgccgtgctgcagttcagcctgttgggagtccccctggtgggagcggac
atatgcggctttgaaggcaacaccaacgaggagttgtgtgtgcgatggatgcagcttggc
gccttttacccgtttatgaggaaccacaatgacaagcccaatgcccctcaggagccgttt
gtatttgggcagaaggcccaagcagccatgcggagtgcgttgaaccttcgctactccctt
ctcccgttcctctatacactcttccatcgcgcgcacacatctgctgacactgtagctagg
cccctcttcatggagtttcccaccgaccctcattgtcagactatagaccaacagttcctg
tgggggagttcacttctcatcagtcctgttttagagcaaggagcagtagagctgagcgcg
tacctaccagctggcacttggtaccaactggacaatggtcagccgttccacagtaacggt
cagtacgtccagctatcggcccctctggaaacaatcaatgttcacgtgagggaggggcac
atcatcccccagcaggaacctgctttaaccaccgcggyttcacgtgaaaaccgtttcttc
ctgacggtggcgctgtccagtggtggctgggcacggggggagttgttctgggatgacgga
gacagccttagaacttttgaaactcaaaattattgttatgttaacttcactgctggacag
tcgcagataattagcgaccctctcaacctcaacggggccttggccagtcttcgtctggga
ggcctccaggtgtttggagtgccttctcaacctctttatgtcttggctaatggagagaaa
gttatagactttacgtataaaactgacacaaaggtcctaacggtgactcgtctggccttg
cctatgtcaaagacatttacagtccagtgggttctatga

DBGET integrated database retrieval system