KEGG   Poecilia reticulata (guppy): 103469404
Entry
103469404         CDS       T05149                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B-like
  KO
K11224  signal transducer and activator of transcription 5B
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04012  ErbB signaling pathway
pret04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103469404
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103469404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103469404
Transcription factors [BR:pret03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103469404
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 Prominin
Other DBs
NCBI-GeneID: 103469404
NCBI-ProteinID: XP_008415278
UniProt: A0A3P9NYY8
LinkDB
Position
LG8
AA seq 787 aa
MMAVWIQAQQLQGDALHQMQSLYGQHFPIEVRHYLSQWIESQLWDAIDLENPQEEFKAKR
LLDSLIQELQNKAEHQVGEDGFLLKIKLGHYANQLKSTYDRCPLELVRCIKHILYTEQRL
IREATNSSSPVGGMMDSMSQKYQQINQAFEELRLLTQDTENDLRKLQHNQEYFIIQYQES
LRIQAQLSSLATLPPSDRQLREPALLSKRATVEAWLTREANTLQKYRLDLAEKHQKTLQL
LRKQQTIILDDELIQWKRRQQLAGNGGPPEGGLDILQSWCEKLAETIWQNRQQIRRAEHL
RQQLPIPGPIEELLNELNSTITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGK
LNVHMNPPQVKATIISEQQAKALLKNENTRNESSGEILNNNCVMEYHQTTGTLSAHFRNM
SLKRIKRSDRRGAESVTEEKFTILFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDNNAT
ATVLWDNAFAEAGRVPFLVPDKVLWPQLCEAINMKYKAEVQSNRGLSEENLVFLAQKAFS
SSSNNPDDYRSMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPHWNDGAILGFVN
KQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERMVWNLMPYTTKDFSIRS
LADRISDLNHLLFLYPDRPKDEVFAKYYTPPLSKAVDGYVKPQIRQVVPDFATANPDPAS
VNSSYMEQGASPAPPNHSHTYAMYPPMADPVLDGDGDFDLDDTMDVARHVEELLRRPVES
QWGGQQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgatggcagtgtggatccaggcccagcagcttcagggagatgctcttcaccagatgcag
tcactgtacggccagcacttccccattgaagtgcgccattatctatcccagtggatagag
agccagctctgggatgctatagacctggagaacccacaagaggagttcaaggccaaacgc
ctcttggacagtctgatacaagagctgcaaaacaaggctgagcaccaggttggagaagat
ggcttccttcttaaaatcaaactgggtcactacgctaaccaactcaagagcacgtatgac
cgctgtcctctggagctggttcggtgtatcaaacacatcctctacacagagcagaggctc
atcagagaggctacaaattcaagctctccggtgggtgggatgatggacagcatgtctcag
aagtaccagcagatcaaccaagcctttgaggagcttcgcctgctcacacaagacactgag
aatgacctgcgcaagctccagcacaaccaggagtactttatcatccagtaccaagaaagc
cttcgcatccaggctcagctgtccagccttgccactctgcccccttctgaccggcagcta
cgggagcctgcccttctcagcaagagagctactgtggaggcatggctgacaagagaagcc
aacacactacagaaataccgcctggacctggcagagaagcaccagaaaacactgcagctg
ttgcgaaagcagcagacaatcattctggatgacgagttgatccagtggaagagacggcaa
cagctggcaggcaatgggggcccgccggaggggggcttggacatccttcagtcctggtgt
gagaagctcgctgagactatttggcaaaacaggcagcagattcggagggcagagcacctt
aggcaacagctgcccattcctggacctatcgaagagctgctcaatgaactcaacagcact
atcacggatatcatctcagctttggtcaccagcaccttcatcattgagaaacagccaccc
caggttctgaagacccaaaccaagtttgctgccacagtacgcctcctagtgggagggaaa
ttgaacgtgcacatgaaccctccacaggtcaaagcaaccataattagcgagcagcaagcc
aaggcattgctgaaaaatgaaaacacaaggaatgagagcagtggagaaattcttaacaat
aactgtgtgatggagtaccaccagactacaggcaccctcagcgctcacttcagaaacatg
tctttgaaaaggatcaagcgatcggacagacgtggagcagagtcagtcacagaagagaag
ttcaccatcctgtttgagtctcagtttagtgttggaagcaaygagcttgtctttcaagtt
aagacattatcacttcctgttgtggtgatagttcatggtagtcaagacaataatgccaca
gcaactgtattgtgggacaatgcgtttgcagaggcaggtcgagtgccttttctggtgcca
gataaggtgctttggcctcagctgtgtgaagccatcaacatgaagtacaaggcagaggtg
cagagcaacagagggctatctgaggagaacctggtcttyctggctcagaaagctttcagc
agctccagcaacaatcctgacgactaccggagcatgacgatgacctggtcacagtttaac
agggaaagccttccaggaagraacttcacattttggcagtggttcgacggtgtgatggag
cttacaaagaagcatctcaagcctcactggaatgacggagccattctgggctttgtgaac
aagcagcaggctcaagatatgctgatgtccaaacccaatggtacctttcttctgcgcttc
agtgactctgagatcggaggtataacaattgcgtgggtggcagaaaatcccaacaaagca
ggtgagcggatggtttggaatctgatgccctacacaactaaagacttctccattcgctct
ctggccgaccgaattagcgatctcaatcacctcctgttcctctatcctgacagacccaag
gatgaggtgtttgccaaatattacacgccacccctctctaaagcggtggatggttacgtg
aaaccacaaatcagacaagtagtgcctgactttgctacagctaatccagacccagccagt
gtaaattcatcatatatggaacagggtgcctctccagcacctcctaatcactctcacact
tatgcgatgtaccctcccatggctgaccccgtgttggacggagacggcgactttgacctc
gatgacaccatggatgtggcgaggcatgtggaggagcttctgcgaaggcctgtggagagt
cagtggggtggccagcagtcctga

DBGET integrated database retrieval system