KEGG   Poecilia reticulata (guppy): 103469572
Entry
103469572         CDS       T05149                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04141  Protein processing in endoplasmic reticulum
pret04210  Apoptosis
pret04217  Necroptosis
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103469572
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103469572
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103469572
   04217 Necroptosis
    103469572
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103469572
   04622 RIG-I-like receptor signaling pathway
    103469572
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103469572
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103469572
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103469572
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pret03019]
    103469572
   04121 Ubiquitin system [BR:pret04121]
    103469572
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103469572
Messenger RNA biogenesis [BR:pret03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     103469572
Ubiquitin system [BR:pret04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    103469572
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf_C2HC_14 zf-C3HC4_2 zf-C3HC4_4 zf-RING_4 MATH zf-RING_5 zf-RING_6 Sina Cyc-maltodext_C
Other DBs
NCBI-GeneID: 103469572
NCBI-ProteinID: XP_008415551
UniProt: A0A3P9PH34
LinkDB
Position
LG9
AA seq 568 aa
MAAQEPSPPSSLEGNKPGFPKKILANNLEDKHLCNSCQKILRRPLQAQCGHRFCSFCFNK
LVSSGPQKCSXCIKEDLFEEPTSILKPGGAFPDNAARREVEALAAVCPNEGCTWTGTVRE
FEASHECNCDFMIIMCPSCKELMRANEQERHNERECPERTLNCKYCKEPFLLKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKFCSKFKTPCRFHVVGCDTSVEKEKIHDHERQCS
YEHLNLLLHFIMGIKVSLESLQPQTLEVASQKLQVLHQSLRELELKMSQLGGGGPAPVQG
ACALTLATSFTPLPSAMGAALELQLQSEKTKVAELSRRCQELELKVNTFENIVCVLNREM
ERSCTTMEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMREMSAATYDGV
FIWKISDFTKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVV
MRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFC
PLSKLDSKNSYIRDDTIFIKAIVDLTGL
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggctgcacaagagccgtctccaccatcttccctggaaggtaacaagccgggcttccca
aagaaaattctggccaacaacctggaggacaagcatctgtgcaactcgtgtcagaaaatc
ctgcggaggcccctgcaggcccagtgcggccaccgcttctgttcgttctgtttcaacaag
ctggtgagttctggaccacagaaatgcagtrcatgcatcaaggaggacttgtttgaggag
cccacctccattctcaagcctggtggtgcgttcccagacaacgcagctcggagagaggtg
gaggccttggcagcagtttgtcctaatgaaggatgcacatggactggaactgtcagagag
tttgaggcaagccatgagtgcaactgtgacttcatgatcattatgtgtccgtcgtgtaaa
gagctgatgagagccaatgaacaggagcgccacaacgagcgagagtgtccagagaggaca
ctgaactgcaaatactgcaaagagccgttcctcttaaagaacatcaaggctcatgatgaa
atctgcccaaagtacccaatgatctgtgaaggctgtgcaaagaaaaagatcccccgtgag
aagtatgtggaccatattaagttctgcagtaaatttaaaacaccatgcagatttcatgtt
gttggctgcgacacgtctgtggagaaggagaagatccatgaccacgagcggcagtgttca
tacgagcacctcaacctgctgctgcatttcatcatgggcatcaaggtgagtctggagagc
ctccaaccgcagaccttagaggtggccagccagaagctccaggtgttgcaccagtccctc
agagagctggagctgaagatgagccagctgggtgggggcggccccgctcccgtgcagggt
gcatgcgctctcaccctggccacgtccttcaccccgctgcccagcgccatgggtgccgcc
ctggagctgcagctccagagcgagaagaccaaggtggccgagctgagtcggcgctgccag
gagctggagctgaaagtgaacacgtttgaaaacatcgtctgcgtcctgaaccgggagatg
gagcgttcctgcactaccatggaagcctacaaccgccagcacagactggaccaggacaag
atcgagattctcagcaacaaggtccgtcagttggaaaggacggtcagcttgagggacctg
tccatcgtggagatggaggggaagatgagggagatgtctgcagccacctacgatggcgtc
tttatctggaagatctctgatttcaccaagaagaggcaggatgccgtagctggycgcgct
cctgctatgttctctcccgcgttttatacgagtaaatacggctacaagatgtgcttacga
atctacctgaatggtgacgggacgggccgcggcacacacctgtctctgttctttgtggtg
atgagaggacacagcgacgcactccttaagtggcctttcaatcagaaggttaccctcatg
ctgcttgaccagaacaacagggagcacataatcgatgccttccggcccgacatctcatct
tcgtccttccagaggcccgtcagcgacatgaacatcgccagcggctgcccgctcttctgt
cctctgtccaagctggactccaaaaactcctacattcgtgacgacaccatcttcataaag
gccatcgtcgacctcactgggctctag

KEGG   Poecilia reticulata (guppy): 103473320
Entry
103473320         CDS       T05149                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04141  Protein processing in endoplasmic reticulum
pret04210  Apoptosis
pret04217  Necroptosis
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103473320
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103473320
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103473320
   04217 Necroptosis
    103473320
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103473320
   04622 RIG-I-like receptor signaling pathway
    103473320
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103473320
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103473320
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103473320
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pret03019]
    103473320
   04121 Ubiquitin system [BR:pret04121]
    103473320
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103473320
Messenger RNA biogenesis [BR:pret03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     103473320
Ubiquitin system [BR:pret04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    103473320
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4_2 zf_C2HC_14 zf-C3HC4 zf-C3HC4_4 SlyX MATH zf-RING_6
Other DBs
NCBI-GeneID: 103473320
NCBI-ProteinID: XP_008421673
LinkDB
Position
LG12
AA seq 596 aa
MATQEPSPPSSMESNKPGFPKKILGNKLEDKHLCNCCHNILRRPFQAQCGHRFCSYCFNR
TVSNGPQRCNACIKEDIFEEPTSVLKQGCAFPDNAVRREVESLSAVCINEDCTWEGTIKE
YELNHEGKCEFMIIPCLSCKERIRFNEQERHNERECPERTLNCKYCKEPFHFKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMSVEKEKIHDHERAYA
YEHLNLLLHFIMGMKVSMEGLQPQGLEVAGHKLLELQQSLRELEARVSQLSTTSSGPPVQ
GAAASSSSSSICSAGPPASAPLPPPPTLPPTLSVSTSFTPLPSSVGAALELQLHSEKTKV
AELGRRCMDLEVKAGTFENVVCVLNREVERFATTMEASNRQHKLDQDKIEALSNKVRQLE
RTVGLKDLTVVEMEGRLREMSATTFDGVFIWRISDFAKKRQDAIAGRAPAMFSPAFYTSK
YGYKMCLRIYLNGDGTGRGSHLSLFFVVMRGLNDALLKWPFNQKVTLMLLDQSNREHIID
AFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDGKNSYIRDDTIFIKAIVDLTGL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggccacacaggagccgtcccctccgtcatccatggagagcaataaacccggcttcccc
aagaagatcctgggcaacaagctggaggacaagcacctgtgcaactgctgccacaacatc
ctgaggcggccatttcaagcccagtgtggacatcgcttctgctcctactgcttcaacagg
accgtgagtaatggaccccaaagatgcaacgcttgcattaaagaagatatttttgaggag
ccgacatcagttttgaagcagggatgtgcatttcctgacaatgccgttcgaagggaagtt
gaaagcctgtctgcagtttgtatcaatgaggactgtacttgggaaggaactattaaagag
tatgagctgaatcacgaggggaagtgcgagttcatgatcatcccctgcctctcctgcaaa
gaacgaatccgcttcaacgaacaggagcgccacaacgagcgggagtgcccggagaggacg
ctcaactgcaagtactgcaaggagccatttcacttcaaaaacatcaaggctcatgacgaa
atctgccccaagtatccgatgatctgtgaaggttgtgccaagaagaaaatacccagagag
aagtatgtggaccacattaagctctgcactaaattccgaactccatgtcgatttcatgtc
gttggatgtgacatgtctgtggagaaagagaagattcatgaccacgaacgcgcttatgcc
tacgagcaccttaacctgctcctgcacttcattatgggtatgaaggtgagcatggagggc
ctgcagccccagggactggaagtagctggacacaaactgttagaactccaacaatccctc
agggaactcgaggccagagtctcccagctcagcaccacctcttctgggcctcccgtgcag
ggagctgccgcttcctcctcttcctcctccatctgcagtgccggcccgcctgcatcagct
cctcttcctccacctcccactcttcctccaacgctctctgtgtctacctcgttcacaccc
ctgcccagctcggtgggcgcagcgctggagcttcagctccacagcgagaagaccaaggtg
gccgagcttggccgcagatgcatggacctcgaggtcaaggcggggacgtttgaaaatgtg
gtgtgcgttcttaacagggaggtggagaggtttgccacaaccatggaggccagcaaccgg
cagcataaactggaccaagacaagatcgaagctcttagtaataaggtacgacagctggag
aggaccgtcggactgaaggacctcacggtggtggagatggagggccgcctgagggaaatg
tccgccaccacctttgatggcgtcttcatctggaggatatcagactttgccaaaaaacga
caagatgccattgcaggtcgggctcctgccatgttctcaccagctttctatactagcaag
tatggctataagatgtgcctgaggatctatctgaatggggacggtacggggcgaggcagc
cacctgtccctgttctttgtggtgatgaggggactgaacgacgctctgctcaaatggccg
ttcaaccagaaggtaaccctgatgctactggaccagagcaatagggagcacatcatcgac
gcctttcgacccgacgtcacttcctcttcctttcaacgacccgtgagcgagatgaacatc
gccagcggctgcccgctcttctgcccgctctccaagcttgacggaaagaactcgtacatt
cgcgacgacacaatattcatcaaagccattgtggacctcaccggcctctag

KEGG   Poecilia reticulata (guppy): 103473816
Entry
103473816         CDS       T05149                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04141  Protein processing in endoplasmic reticulum
pret04210  Apoptosis
pret04217  Necroptosis
pret04621  NOD-like receptor signaling pathway
pret04622  RIG-I-like receptor signaling pathway
pret04920  Adipocytokine signaling pathway
pret05132  Salmonella infection
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103473816
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103473816
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103473816
   04217 Necroptosis
    103473816
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103473816
   04622 RIG-I-like receptor signaling pathway
    103473816
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103473816
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103473816
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103473816
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pret03019]
    103473816
   04121 Ubiquitin system [BR:pret04121]
    103473816
Enzymes [BR:pret01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103473816
Messenger RNA biogenesis [BR:pret03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     103473816
Ubiquitin system [BR:pret04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    103473816
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4_4 zf-C3HC4 zf-C3HC4_3 zf-RING_5 zf-C3HC4_2 zf-RING_2 zf-RING_6 Sina Noelin-1 Paramyxo_NS_C zf-RING_UBOX
Other DBs
NCBI-GeneID: 103473816
NCBI-ProteinID: XP_008422550
LinkDB
Position
LG12
AA seq 519 aa
MARISLDSQNSLPGIPLSVLSVPMENKYKCQQCLQVLRKPVQAQCGHRFCVHCFKLLTSA
GPKPCEACRQEEIYEEPMSILNSNEAFPDNAAGREIASLPARCLNQGCSWTGSIKEYEAQ
HEGRCENERVQCEACQASIVLKDKDRHNERECEARTLNCKYCKVAFNFKDIKAHDEICLK
FPLQCKDCGKKKIPREKFSDHIKSCVKSKSACPFSEVGCKTVIENGKLSDHEHNSTMEHL
RLLLPMVLTMTHLTHPRSEALGSGELQEDSGLGLYRAPEEGDGAAAAAQPIDLEKKVIAL
ENIVCVLNREVERSSLTLEAFAHQHRLDQEKIENLSNRVRQLERTVTMRDLQLSETEQLV
RELQNCTYDGIFVWKITDFSRRRQEAVAGRTPAMFSPAFYSSKYGYKMCLRLYLNGDGTG
RGTHLSLFFVVMKGKCDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDISSTSFQRPISE
MNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDLTGL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggctcgcatctctttggactctcaaaactctttaccaggaattcctttgagtgtgctg
tctgtgcccatggagaataagtacaaatgtcagcagtgtctccaggtcctgaggaaacct
gtccaggctcagtgtggccaccgcttctgtgtgcactgcttcaagctgctcaccagcgct
ggtccaaagccttgtgaagcctgccgccaagaggagatctatgaggagcccatgtccatc
ctgaacagtaacgaggcgtttccagacaacgcagccggtcgagaaatagcgagtctgcct
gccaggtgtttgaaccagggctgcagctggactggatctataaaagagtacgaggcgcaa
catgaaggccgctgtgaaaatgaacgggtgcagtgcgaggcctgccaggcctccatcgtc
ctcaaggacaaggacagacacaacgagagggaatgcgaggcgagaacgctcaactgcaaa
tactgcaaagttgctttcaactttaaagacattaaggcccacgatgagatctgtctcaag
tttcccttacaatgtaaagactgtggcaagaagaagatccccagagaaaagttcagtgac
cacatcaaatcctgtgtaaagtccaagagcgcctgtccattcagcgaagtgggctgtaaa
actgtgatagagaacgggaagctgagcgaccatgaacacaacagcaccatggagcaccta
cgcctgctgctgccgatggtgctgacgatgacccatctgacccatccacgaagcgaggcc
ctgggatccggggagctgcaggaggactcgggtctgggtctgtacagagctcctgaggag
ggagacggcgctgcagccgccgcacagcctatagacctggagaaaaaagtaattgcttta
gaaaacattgtgtgtgtcctgaaccgagaagtggagcgcagttcgctcaccctggaggct
ttcgcccaccagcatcgactcgaccaggagaaaatcgaaaacctgtcgaacagagtgcgg
cagctagagcgaacagtgaccatgagagacctgcagctgtcggagaccgagcagctggtg
cgcgagctccagaactgcacctacgacgggatattcgtctggaaaatcacagacttctcc
cggcgcaggcaggaggccgtggccggccgaacgcctgccatgttctcacccgcattttac
tccagcaaatacggctacaaaatgtgtctcaggctatatttgaacggcgacgggaccgga
cgggggacgcacctctccctgttctttgtggtcatgaagggaaagtgcgacgctctgcta
aagtggcccttcagtcaaaaggtgactctgatgctcctggatcagaacaacagggagcac
atcatcgatgctttccgacccgacatctcctccacctccttccagcggccgatcagcgag
atgaacatcgccagcggctgcccgctcttctgtccactggctaagctggccggcaagagc
ccatatctgagagatgatacgatatttatcaaagcgatcgtagacctcacaggcttgtga

DBGET integrated database retrieval system