KEGG   Poecilia reticulata (guppy): 103469946
Entry
103469946         CDS       T05149                                 

Definition
(RefSeq) tyrosine-protein kinase JAK2-like
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04217  Necroptosis
pret04920  Adipocytokine signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103469946
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103469946
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103469946
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103469946
Protein kinases [BR:pret01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   103469946
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl RIO1 Kdo
Other DBs
NCBI-GeneID: 103469946
NCBI-ProteinID: XP_008416253
UniProt: A0A3P9NS13
LinkDB
Position
LG9
AA seq 1122 aa
MLLMASPPAMDTVTDSRPTVHQNGNAHRESSDTRPAAPVLRLHFYYRSQGAADSGTLSYP
PGNYVAEELCIDAAKACCISPLYYNLFSLFRERDNLWFSPNHVFRVDESTSEDLIFRIRY
YFPGWYSSGASRAYRYGVKKGSESPVLDDYVMSYLFSQWRNDFVNGVVTISNSHESQEEC
LGMAVLDMTRTAKERQMSPLDIYHNTSYKSFLPKDMRNQIQDCSFLTRKRIRFRFKRFIQ
QFSQCRTTVRDLKLKYLISIESLEKAFYTETFQVREPASGQLIILVAADTGIQWCREKLK
DSDEEPQTLCDFHDVTDISIKQACKEGTTESRLVTINKQDGKNLELEFPSLFEALSFASL
VDGYYRLTTDAHHYLCKEVAPPRLVEAISCHCHGPISMEFAVSRLQKCGDKRGLYILRCS
PKDFNKYFLTFPVEVFDTVDYKHCQITRSAAGEFNLSGTKRNFSSLQELLSCYQKETVRS
DGIVFQFRKCYPPLSKEKSCLLICRSNKGSEVPLSPSLQRHNVSQMVFHKIRKEDLEFVE
SLGQGTFTKIFKGVRKELGDYGQMHETEVGMKVLDQAHRNYAESFFEAASMMSQLSHKHL
ILNYGVCVCGEENIMVQEYVKMGSLDTYLKKNKNSINIQWKLEVAKQLAWAMNFLEEKHL
VHGNVCAKNVLLIREEDRRAGNPPFIKLSDPGIGITVLPKEILIERIPWVPPEYINEPMT
LSLAADKWSFGTTLWEICSGGEKPLAMLDNTKKVLFYNDHQQLLAPKWTEIANLIASCMD
YEPTFRPTFRAVIRDLHGLFTPDYELIMDDILPNRTTGAGGTAGSFENQEPALFQERHLI
FLQLLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTAEHMRDFEREIEILKSLQHENI
VKYKGVCYSAGRRNLRLIMEYLPFGSLRDYLIKNMERIDHKKLVHYASQICKGMEYLSSK
RYIHRDLATRNILVESELRVKIGDFGLTKVLPQDKEYYMVQEPGESPIFWYSPESLTESK
FSVASDVWSFGVVLYELFTHSYKNCSPPAVFMSMMGNDKQGQLIVYHLIELLKSGSRLPQ
PLGCPSEIYQIMEECWDKDPTSRPSFNELALRIDLIRDTEEF
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgttgctgatggcttccccgccagctatggacactgtgacggactcgcgtcccacagtg
caccagaacgggaacgcccatcgtgaatcttcagacacaagaccagctgctcctgttctg
aggcttcatttctactaccgcagccagggagcagctgacagcggcactctcagctaccca
cccgggaactacgtggctgaggagttgtgtatagatgcagccaaggcgtgctgtatatca
cccctgtactacaacctttttagcctttttcgagagagagacaacttgtggttttctccc
aatcacgtctttcgagttgatgaatcgacctctgaagatctgattttcagaatacggtac
tacttccctggctggtacagtagtggtgcatcgcgagcatatcgatatggggtcaagaaa
gggtcagaaagtcccgtccttgatgattatgtaatgtcctacctcttctctcagtggagg
aatgactttgtgaacggagtggtgacgatttccaactcccacgagtcacaggaggagtgc
cttggtatggctgtgctggacatgacgaggacagctaaggagagacagatgtcccctctg
gacatctatcacaatacaagttacaagtccttcctaccaaaggatatgagaaatcagatc
caggattgtagttttttaactcgtaagaggatccgctttcgcttcaagcgcttcatccag
cagttcagtcagtgtcggacaacggtgcgcgacctgaagctgaagtatctcatcagcatc
gagtcgctggagaaagccttctacacggagacctttcaggtcagagaaccagccagcggg
cagctcatcatcctggtggcagcggacacagggatacagtggtgccgagagaaattaaaa
gattcggatgaggagccgcagacattgtgcgacttccatgatgtcacagacatcagcatc
aaacaggcctgcaaagaaggcaccacagagagccggttggtcaccatcaacaagcaggac
gggaagaacctggagctggagtttccgagtctgtttgaagccttgtcattcgcgtccctc
gttgacggctactatcgactgaccacagatgcacatcactacctttgtaaggaggtggcc
cctcccaggcttgttgaggccatatcttgtcattgccacggccccatttcaatggagttt
gctgtcagccggcttcagaagtgtggagacaagcggggcttatacattttgagatgcagc
ccaaaagacttcaataagtattttctaactttcccagtggaggtgtttgatacggtggat
tacaagcactgtcagatcaccaggtccgccgctggagagtttaacctcagtggaaccaag
aggaacttcagctcactgcaggagttgctcagctgctaccaaaaagaaacggtgcgctcg
gacggcatcgtgttccagttcagaaagtgctatccccctctgtccaaagaaaagtcctgc
ctcctcatctgcaggagcaacaaaggttcagaagtgcctctgtctccgtcgctacaacga
cacaacgtcagtcagatggtgtttcacaagatcaggaaagaagacttggagtttgtggag
agtcttggtcaaggcacatttacaaagatctttaaaggagttcgcaaggagctcggcgac
tacgggcaaatgcacgaaactgaagttgggatgaaagttctggaccaggcccacagaaat
tacgccgagtctttctttgaagcagccagcatgatgagccagttatcccataaacacctg
atcctcaactatggagtttgtgtctgtggagaagagaacatcatggtgcaggaatatgtg
aagatgggttcgctggacacctacctgaagaagaacaagaactctataaacattcagtgg
aagctcgaagtggcaaaacagctggcctgggctatgaacttcctggaggaaaagcatctt
gtccatgggaatgtttgtgccaaaaatgttctgctgatcagggaggaggatcggcgggct
gggaatcccccgttcatcaagcttagcgaccccggtatcggcatcactgtcctgcctaaa
gaaatcctgattgaaaggatcccctgggtgcctcctgaatacataaacgagccgatgact
ctgagcctggctgcagacaagtggagcttcggcaccacgctgtgggaaatctgcagcggc
ggagagaagccactggcaatgctggacaacacaaagaaagtcctgttctacaacgatcac
cagcagcttctggcaccaaagtggacagaaattgctaacctgatcgccagctgcatggac
tacgagccgacgttcaggcccacattccgggcggtgatccgcgaccttcatggcctcttc
acaccggactacgagctgatcatggatgacatcctgccaaaccgaacaacaggtgctggt
ggcacagctggcagctttgagaatcaggagccagctctgtttcaagaacggcatctcata
tttttacagttactcggcaagggaaactttggcagtgtggagatgtgccgctatgacccg
ctccaggacaacaccggagaggtcgttgctgtgaagaaactccagcacagcacagcggag
cacatgcgagattttgagagggaaattgagattctgaaatctctccagcatgagaacatc
gtcaagtataagggtgtttgttacagcgcaggtcgacgtaatcttcgcctcatcatggag
tatcttccctttggaagtcttcgcgattacctcataaaaaacatggagcggatcgaccat
aaaaagctggtccactatgcctctcagatctgcaagggaatggagtacctgtccagtaag
cggtacatccacagagacctggcgacacgcaacatcctagtcgagagtgagctcagagtg
aaaattggagacttcggcctcaccaaagttctgcctcaggacaaagagtattatatggtc
caagagccgggagagagtcccatattctggtattcccctgagtcactgactgagagcaag
ttctctgtggcttcagacgtctggagctttggagtggtgctgtatgagctcttcacacac
agttacaagaactgcagccctcctgcagtatttatgtcaatgatgggtaacgataagcag
gggcagctgatcgtctatcacctcattgagctcctcaaatcaggcagcaggctgcctcag
cccctgggttgtccttcagagatctaccagatcatggaggagtgttgggataaagaccca
acctcacgtccgtcttttaacgagctggctctgcgcatcgacctgatcagggacactgag
gagttttaa

KEGG   Poecilia reticulata (guppy): 103473642
Entry
103473642         CDS       T05149                                 

Gene name
jak2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04217  Necroptosis
pret04920  Adipocytokine signaling pathway
pret05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103473642 (jak2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103473642 (jak2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103473642 (jak2)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103473642 (jak2)
Protein kinases [BR:pret01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   103473642 (jak2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 Kdo
Other DBs
NCBI-GeneID: 103473642
NCBI-ProteinID: XP_008422251
LinkDB
Position
LG12
AA seq 1124 aa
MAFILLTDMDPLSSNPTTVDSLSTDPDPKQEIKAVTLTLHLYHLGKTEGRGTCSDDTLTF
PPGEYVAEELCITAAKACGISPVYCSLFCLMRENDRIYFPPNHVFKLHNSASENLLFRIR
YYFPGWYNSSSSFYAHRYGLSKEMESPVMDDCVMAYLFAQWRSDFLNGWVHIPVSHEAQE
ECLGMAVLDMMRLAKESDLSAVDIYNDTSYKSFLPRCMRDRIQEYNLLTRKRIRYRFRRF
IQQFSECKATVCNLKLKYLMNLEMLLPSVYSERFQVTDLSSREVTIVVMGNKGILWSKGK
GEEGAEEELELYCDFPEVIDISIKQGSKEGSAESRIVSLTRQDNQILELEFQLLSEALSF
VSLVDGYYRLVADAHHYLCKEVAPSRLLECIQSYCHGPVSMEFTISKLRRLGNYQGLYIL
RCSPREYDKFFMSFVVGYETMVDYKHCQIVKTESGEFILSGAKRSFGSLKELMHCYQKEA
LRTDGYTFQLIRCCPPSQKDKSNLLVCRNNQSTDVPPSPSLHKHINQMVFHKIRKEDLVF
NESLGQGTFTKLFRGVRKELGDYGEVHQMDVAVKILDKAHRSFSESFFEAASMMSQLSHK
HLLLIYGVCVCGDENMMVQEYGKFGSLDIYLKKKKNCINITWKLEVAKQLAWAMHYLEDK
SVVHGNVCAKNILLIREEDRKTGSLPFIKLSDPGISITVLPREVLVEHIPWVPPECIENP
QNLSLATDKWGFGTTLWEICSGGEKPLSTLDSSKKNLFYEDRHQLPAPKWTELANLINSC
MDYEPLHRPSFRTIIRDLNSLFTPDYELLVESDMVPNRTRGFGFPWASVSQEPAQFEERH
LIFLKQLGKGNFGSVEMCRYDPLQDSTGEVVAVKKLQHSTAEHLRDFEREIEILKSLHHE
NIVKYKGVCYSAGRRNLRLIMEYLPFGSLRDYLIKHKDRMDSMKLLHYASQICKGMDYLG
GKRYIHRDLATRNILVESEMRVKIGDFGLTKVLPQDKEYYTVREPGESPIFWYAPESLTE
SKFSVASDVWSFGVVLYELFTYSDKNCSPPAVFMEKMGNEKQGQMIVYHLIDLLKQGYRL
PAPENCLKEIHKIMMECWSSDPKLRPTFKALIQQVETVRESKDG
NT seq 3375 nt   +upstreamnt  +downstreamnt
atggcctttattctgctgacagacatggaccctctttcttccaacccgacaacagttgac
agcttatccacggaccctgaccccaagcaggaaataaaggcagttactttaactcttcac
ctttaccacctgggaaagactgaaggacggggcacctgctcagacgacaccctcacattt
ccaccgggagagtatgtagcagaggaactgtgcatcactgctgccaaagcttgtggaatt
agcccggtgtactgcagcttgttttgtctgatgagggaaaatgaccgaatttattttcct
cctaatcacgtcttcaaactgcacaactcagccagtgaaaacctgctcttcagaatcaga
tactattttccaggctggtataacagcagtagctccttctacgcccatcgttacggcttg
tccaaagagatggaaagcccggtaatggacgactgtgtcatggcctacctgtttgctcag
tggcgcagtgactttttaaatggctgggttcatattccggtcagccacgaagctcaggag
gagtgcctgggcatggctgttctcgacatgatgaggctcgctaaagagagtgacctgtca
gcggtggatatctacaatgataccagctacaagtccttcctccccagatgcatgagggac
cgcatccaagagtataacctgctgacccggaagaggatccgctaccgcttccgacggttc
atccagcagttcagtgagtgcaaagccactgtatgcaacctgaagctcaaatacctgatg
aacctggagatgctgctgccctctgtgtactctgagcgcttccaagtgactgacctgtcc
tcgcgagaggttaccatcgtggtgatgggcaacaagggcatcctttggtctaaaggaaaa
ggagaggagggagcagaggaggagctggagttatattgtgatttcccagaggtgatcgac
atcagcatcaaacagggcagcaaggaaggctcagcagaaagtcgcatcgtttccctcacc
agacaggacaatcagatcttggagctggagttccagttgctctccgaggccctgtctttt
gtttctctggttgatggatattaccgactggtcgctgacgcccatcactacctgtgtaaa
gaagttgccccatcgagacttctcgagtgcattcagagttactgccatggccctgtatcg
atggagttcacaattagcaagctgcgtcgtttgggtaactatcagggcctctacatccta
cgctgcagcccccgagagtatgacaaattcttcatgtcctttgttgttgggtatgaaacc
atggtggattataagcactgtcagattgtgaagacagagtcgggagagttcatcctgagc
ggcgccaaaagaagctttggttctctgaaagaactcatgcattgctaccaaaaggaggcg
cttcgcaccgatgggtacactttccagctcatcaggtgctgtccacccagtcagaaagat
aaatccaacctgctggtgtgcagaaataaccaaagcacagatgtccctccgtctccatca
cttcacaaacacatcaaccagatggttttccacaaaatccgcaaagaagaccttgtcttt
aatgaaagtctgggccaaggaacgtttacgaagctctttcgcggtgtgaggaaggaactg
ggtgattacggggaggttcaccagatggacgtggcggtcaagattctggacaaggctcat
cgtagtttttcagagtccttctttgaggccgccagcatgatgagccagctgtcccacaag
cacttactcctcatttatggtgtgtgtgtttgtggcgacgaaaacatgatggtgcaggaa
tatggaaagtttggctctctggatatttatctgaaaaagaagaaaaactgcatcaacatc
acctggaagctagaagtggccaaacagttagcctgggctatgcattacctggaggataaa
agtgtagttcatgggaatgtttgtgccaaaaacattctgctgatcagagaggaggaccgg
aagacgggcagcctgcctttcatcaagctcagtgatcctggtatcagcatcaccgttctg
cccagagaagttctggtggagcatatcccgtgggtgccccccgagtgcatcgaaaacccg
cagaatctgagcttagcaaccgacaagtggggcttcggaacgacgctttgggagatctgc
agcgggggagaaaaaccgctcagcaccctggactcctcaaagaagaacctgttctatgag
gacagacaccagctgccggctccgaagtggactgagttggccaacctgataaacagctgc
atggactacgagcctttacaccgaccctccttcaggacgatcatcagagacctcaacagt
cttttcactccagattatgagctgctggtggagagtgacatggtgcccaacaggacccga
gggtttggcttcccgtgggcctcagtgagccaggagccagcgcagtttgaggagagacac
ttgatcttcctcaagcagctgggcaaaggcaactttggcagcgtggagatgtgccggtac
gacccgctgcaggacagcaccggggaggtggtggctgtgaagaagcttcagcacagcacg
gctgagcacctccgggactttgagcgggaaatcgaaatcctcaaatcgcttcaccatgag
aacattgttaaatacaaaggagtgtgctacagtgcaggaagaagaaaccttcgtctcatc
atggagtacctccccttcggcagcttgagagattatctcatcaaacacaaggaccgcatg
gattccatgaaactgcttcactacgcgtcgcagatatgcaagggcatggactacctcggt
gggaagcgttacattcacagagacctggccaccaggaacattctggtggagagcgagatg
agggtgaagatcggcgattttggcctaaccaaagtgctgccacaggacaaggagtactac
actgtcagggagcctggggagagccccatcttctggtatgcccccgagtcgctgacagag
agcaagttctcagtagcatcagacgtttggagcttcggcgttgttctgtatgagctcttt
acctacagtgacaagaactgcagccccccagcggttttcatggagaagatgggaaatgaa
aagcagggccagatgatcgtctaccatttgatcgacctgctgaaacagggatacagactc
cctgctcctgaaaactgcctaaaggagattcacaagatcatgatggagtgctggagcagt
gacccgaaactgcggcccacattcaaggccctgatccagcaggtggagaccgtgcgggag
agcaaggacggatga

DBGET integrated database retrieval system