KEGG   Poecilia reticulata (guppy): 103470005Help
Entry
103470005         CDS       T05149                                 

Gene name
gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00052  Galactose metabolism
pret00500  Starch and sucrose metabolism
pret00520  Amino sugar and nucleotide sugar metabolism
pret00524  Neomycin, kanamycin and gentamicin biosynthesis
pret01100  Metabolic pathways
pret01200  Carbon metabolism
pret04910  Insulin signaling pathway
Module
pret_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pret_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103470005 (gck)
   00052 Galactose metabolism
    103470005 (gck)
   00500 Starch and sucrose metabolism
    103470005 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    103470005 (gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103470005 (gck)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103470005 (gck)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     103470005 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103470005
NCBI-ProteinID: XP_008416330
LinkDB All DBs
Position
LG9
AA seq 475 aa AA seqDB search
MPCISSQLDQMMKLPGSHSDVVEKLCMVEQILSEFRLNKEELEEVMKRIQHEMNRGLRLE
THQEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEEGSFKVETKNQMY
SIPEDAMTGTAEMLFDYIAECMSDFLDKHHIKHKKLPLGFTFSFPVRHEDLDKGILLNWT
KGFKASGAEGNNIVGLLRDAIKRRGEFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGT
GCNACYMEEMRTVELVEGEKGRMCVNTEWGAFGDSGELEEFRLEYDRVVDETSINPGHQL
YEKIISGKYMGELARLVMMKLVNENLLFNGEASEQLKIRGSFETRFVSQVESDSGDRKQI
YNILSSLGVLPSELDCDIVRLVCESVSTRSAHMCGAGLAGVINQMQEHRGQDTMKITVGV
DGSVYKLHPYFRDRFHQVVRELTPHSEITFLQSEEGSGRGAALISAVACKMASWI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgcatcagcagccaactcgaccagatgatgaagctccccggtagccacagtgac
gtggttgaaaaactctgcatggtggagcagatcctgtctgagtttagattgaacaaagag
gagctggaagaagtcatgaagaggatacagcatgaaatgaacagaggactgcgtttggag
acccaccaagaggccagcgtcaaaatgcttccgacctacgtctgctccacccccgaggga
tcagaagtgggagatttcttggctcttgacctcggagggacaaatttccgtgtgatgctt
gtgaaagtgggtgaagacgaagagggaagtttcaaggtggagacgaagaaccaaatgtat
tccatccctgaagatgccatgacggggactgctgaaatgctgtttgactacatagcagaa
tgcatgtctgactttttggacaaacaccacatcaagcacaagaagcttcctctgggtttc
accttctccttccctgtacgacatgaagaccttgataagggaattttgcttaactggacc
aaaggtttcaaggcctctggggctgaagggaacaatattgttggtttgctcagagatgca
atcaagagacgaggggagtttgagatggatgtggttgccatggtgaatgacacagtagca
accatgatctcctgctactatgaggacagaagctgtgaagtcggaatgattgttggtact
ggctgcaatgcctgttacatggaggagatgaggactgtggagctggtggagggggagaag
ggccggatgtgtgtgaacactgagtggggagcatttggagactcaggcgagctggaggag
ttcaggctggagtacgacagagtggtggacgagacctcaatcaaccctggacaccagctg
tatgagaagattatcagtggaaagtacatgggggagctggcgagactcgtcatgatgaag
ctggtgaatgagaacctgctgtttaacggcgaagcctcagagcagctgaagatacgaggc
agctttgagacacgctttgtctcccaggttgaaagtgactctggcgacagaaagcagatc
tacaacatcctctcctctctgggcgtccttccctctgagctggactgcgacattgtgcgt
ctggtctgtgagagcgtctccactcgctctgctcatatgtgtggcgcaggtctcgctggg
gtcattaaccagatgcaagagcaccgcggccaagataccatgaagatcacagtcggggtt
gacggatccgtctacaagctgcacccttatttccgtgaccggttccaccaggtcgtcagg
gaactcacccctcattctgagataaccttcctgcagtcggaggagggcagcgggcgtgga
gctgctctgatctctgcagtggcttgtaagatggcatcatggatctga

DBGET integrated database retrieval system