KEGG   Poecilia reticulata (guppy): 103470150Help
Entry
103470150         CDS       T05149                                 

Gene name
htr1a
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103470150 (htr1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    103470150 (htr1a)
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103470150 (htr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv Cyt_bd_oxida_II ABC2_membrane_3
Motif
Other DBs
NCBI-GeneID: 103470150
NCBI-ProteinID: XP_008416559
UniProt: A0A3P9PRH1
LinkDB All DBs
Position
LG9
AA seq 426 aa AA seqDB search
MDFLTSSNASNATGGYPEGMDVVADWIGGNNTTESRFQPDLVLAYQIITSLLLGALILCS
IFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICD
LFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPKRAALLISATWLIGFSISIP
PMLGWRSAEDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTV
KKTETAKVSDKCLAVSPAIFHKKSNGETRGKGWRRCDEFKSSSPCVNGAVKHGEEGESLE
IIEVISNSKTHLPLPNTPQSSSHGYENMNERNSGAKRKLALSRERKTVKTLGIIMGTFIV
CWLPFFIVALVLPFCAESCYMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIK
CKFHRP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggattttctaacgagcagcaacgccagcaatgccaccggcggttaccccgaagggatg
gacgtggtcgccgactggatcgggggtaacaacaccacggagtctaggtttcaacccgat
ctggtgcttgcttaccagataatcacctctctgctcctgggggccctcatcctctgctcc
atatttggcaacgcgtgcgttgtggcagccatcgccctggagagatctctccaaaatgtg
gcaaactatttgattggatctttggccgttacagacctgatggtgtcggtgttggtttta
cctatggcagccctctaccaggttctaaataagtggactttggggcaggagatctgtgac
ttgttcatctccctggatgtgttgtgctgcacatcctccatcctgcatctgtgcgcaatc
gccttggacaggtattgggccataacagaccccattgattatgtaaataaacgaacacca
aaacgagctgcgctcctgatttccgcaacttggctgatcggattctccatctccatccca
cccatgttaggatggaggagcgccgaggacagggcgaacccagacgcatgcatgatcagc
caggatccaggctacaccatctactccaccttcggggctttttacatccccctcatcctc
atgctagtcttgtacggcagaatattcagagccgctcggtttcggattcgaaaaacggtg
aagaaaaccgagacggcgaaagtttcggacaagtgtttggccgtgtctccggcaatcttc
cacaagaaaagcaacggggagacgcgcggcaaaggctggaggcgctgcgacgagttcaaa
tccagctccccgtgcgtaaacggcgctgtgaagcacggagaggagggcgagtcgctggag
attatagaagttatcagcaactccaagacgcacctacctctgcctaacacccctcagtcc
tcctctcatggttatgagaacatgaacgagaggaactcgggagcaaagagaaagcttgcg
ctctccagggaacgcaaaacggtgaagacgttggggatcatcatgggaacattcattgtg
tgctggctgccgtttttcattgtggcgctagttctgcctttctgcgcggagagctgctac
atgcccgactggctgggtgccgttatcaactggcttggctactcaaactccctccttaac
cccataatatatgcctattttaacaaagactttcaaagtgcattcaagaagatcataaag
tgcaaattccacagaccatga

DBGET integrated database retrieval system