KEGG   Poecilia reticulata (guppy): 103470212Help
Entry
103470212         CDS       T05149                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret01100  Metabolic pathways
pret01200  Carbon metabolism
pret04910  Insulin signaling pathway
Module
pret_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pret_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103470212
   00051 Fructose and mannose metabolism
    103470212
   00052 Galactose metabolism
    103470212
   00500 Starch and sucrose metabolism
    103470212
   00520 Amino sugar and nucleotide sugar metabolism
    103470212
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103470212
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103470212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103470212
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103470212
Membrane trafficking [BR:pret04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103470212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103470212
NCBI-ProteinID: XP_008416685
LinkDB All DBs
Position
LG1
AA seq 923 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDETLKDIMGRFRRDMENGLGRDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQVYDTPDDIIH
GSGTQLFDHVAECLGDFMEKQKIKDKRLPVGFTFSFPCVQSKLDEAVLVTWTKKFKANGV
EGMDVVKLLNKAIKKRGDYQADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHMDLVEGDEGRMCINTEWGAFGDNGSLEDIRTEFDREIDRGSLNPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKTKEGLKKCMEILTRLG
VEPSDEDCLAVRHVCTIVSFRSANLISATLGAILSRLKDNKGVGRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLTDQARQIQETLAEFRLS
KGQLLEVKKRMRMEIERGLKKDTHKEATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCHQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKELEDPEFELDVVAIVN
DTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEELKNIEIVGGTEGRMCVNMEWGAFGDNG
CLDDIRTKYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGA
GMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIFHQTVKELAPKCDVNFLLSEDG
SGKGAALITAVGCRQRELDAQQH
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctcagcttctggcctactacttcaccgagctgaaggatgatcagctcaag
aagattgataagtacctttactccatgcgtttctctgacgagacgctgaaggacatcatg
ggccgtttccgtagggacatggagaacggactcggccgagacacgaaccccacagcgacg
gtgaagatgctgcccacctttgttcggtccatccctgatggatcagaaaagggggacttc
atagctcttgatcttggtgggtcaaactttcggatcttgcgtgtcaaagtgacacaggac
aagaagcagccagttcagatggagagccaggtttacgacactcctgatgacatcatccat
gggagtgggacacagctctttgaccatgtagctgagtgcctgggtgattttatggagaaa
caaaaaattaaggataaaagactacctgtgggatttacgttctccttcccctgtgtccaa
tccaaactggatgaggccgtccttgtgacttggacaaagaaatttaaggctaatggtgta
gagggaatggatgttgtgaaacttctcaacaaggcaattaagaaacgaggggactatcaa
gcagacatcatggcagtggtgaacgacacagttggcaccatgatgacatgtggatttgac
gatcagcgttgtgaagtgggaatcattataggaacggggacaaacgcctgctacatggag
gaactgcgtcacatggatctggtagaaggcgacgaaggccgaatgtgcattaacaccgaa
tggggggcttttggggataacggctccttggaagacattcgtacagaatttgatcgagag
attgacagaggttccctcaacccaggaaagcaattgtttgagaagatggccagtggaatg
tacatgggagagctggttcgactcatcctagtgaagatggccaaggaggggctcctgttt
gagggaagaatcactcctgagcttctgaccaaaggaaagatcgaaacaaagcatgtttct
gccatagagaagactaaagaaggactgaagaaatgtatggagatcctgaccagacttggt
gtggaaccatcagatgaagattgcctggcagtcaggcatgtatgcaccattgtgtccttc
cgctctgcaaatctgatttctgcgactctgggagctatcctctcacgcctaaaggacaac
aaaggagttggacgccttcgcacgactgtgggaattgatggttctctctacaaaatgcac
cctcaatacgcccggcgcttgcacaagaccgtacgtcgtttggttccagactctgatgtc
cgcttcctgctgtctgaaagtgggagtggcaaaggtgccgccatggtgacagcagtggcc
taccgtttgaccgaccaggcgcgccagattcaggagactttggcagagttcaggctgagc
aaaggtcaactgctggaggtgaagaaacgcatgagaatggaaatcgaaagaggcctgaag
aaggacacccacaaggaggcgacagtcaaaatgctgcctacatttgttcggagtacacca
gatggaacagaaaatggagattttctagctttggaccttggaggaacaaacttccgtgtg
cttttggttaagattcgcagtgggaagaagcgcacagtagaaatgcataacaaaatctac
gccattcccatagaagtcatgcagggcacaggagaggagctttttgaccacattgtgcac
tgcatctccgacttcctggactacatgggaatgaaaagcgctcgactgccgctgggtttc
accttctccttcccctgtcaccagaccagtctggatgcaggtatcctggtaacctggaca
aaaggcttcaaggcaacagactgtgaaggtgaagatgttgtggagcttctccgagaagca
atcaaaagaaaagagcttgaagacccagagtttgagctggatgtggttgccatagtgaac
gacaccgtgggaacgatgatgacctgtgcgtatgaagagccaacatgtgaagtcggactg
attgccggcacaggaagtaatgcctgctacatggaggagctgaaaaacatcgaaatagtg
ggaggcaccgagggtcgaatgtgtgtcaacatggagtggggggcgtttggagacaacggc
tgtctggacgacatcaggacaaaatatgatcaggcagtggacgaaaactcactcaacgaa
ggcaaacagagatatgagaagatgtgcagtggaatgtatttgggagaaattgtgcggcag
attttgattgatctgacgaagcgtggcttcctcttccgaggacagatttcagagacactg
aagactcgcggcatctttgagaccaaattcctgtcacaaatagagagcgatcgtctggcg
ctgctgcaggtcagagcgatcctgcagcagctgggactcgacagcacctgtgacgacagt
attatcgttaaggaggtgtgtggaactgtgtcccgccgcgccgctcagatctgcggagcc
ggaatggccgccgtggtggacaagatccgtgagaaccgaggactggaccacttggacatc
accgtgggtgtggacggcacgctgtacaagctgcacccacacttctctcggatcttccac
cagacagtaaaagaactcgcccctaaatgtgacgttaacttcctgctgtcggaggacggc
agtggcaagggagctgctctcatcactgccgtgggctgccgccagagggagctagacgcc
cagcaacactga

DBGET integrated database retrieval system