KEGG   Poecilia reticulata (guppy): 103470346
Entry
103470346         CDS       T05149                                 

Gene name
acacb
Definition
(RefSeq) acetyl-CoA carboxylase 2 isoform X1
  KO
K01946  acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00061  Fatty acid biosynthesis
pret00620  Pyruvate metabolism
pret00640  Propanoate metabolism
pret01100  Metabolic pathways
pret04910  Insulin signaling pathway
pret04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103470346 (acacb)
   00640 Propanoate metabolism
    103470346 (acacb)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103470346 (acacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103470346 (acacb)
   04920 Adipocytokine signaling pathway
    103470346 (acacb)
Enzymes [BR:pret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     103470346 (acacb)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     103470346 (acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     103470346 (acacb)
SSDB
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp_3 ATP-grasp THEG4 ATP-grasp_4
Other DBs
NCBI-GeneID: 103470346
NCBI-ProteinID: XP_008416945
LinkDB
Position
LG9
AA seq 2420 aa
MFLLPALAVIWILILLWINKTKTAAMHRSNKKSEEEYVSTAESSSRSRQRSLSTAAPKSK
FSSESADVSAKRAEPDPLQASLKVNSWQPLPLQTTQKPANTVPPMLSPRAAARERLKFFL
GASEDNSSDDEVLVTKPPSGASQPTTSAPKSAAELVPADVLSPSSSVLKPSMSGPHLVKK
GREHRKMDLQRDFTVASPAEFVTRFGGNRIIEKVLIANNGIAAVKCMRSIRRWSYEMFRN
ERIIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELIVDIAKRIPVQAVWA
GWGHASENPKLPELLNKSGITFLGPSSKAMWALGDKVASSIVAQSADIPTLPWSGSGLRV
AWTEEDQRRGYVVSVPPEIYKEGCVHDVDDGLAGAEKIGYPVVIKASEGGGGKGIRKVEN
SDEFPSFFRQVQTEVPGSPIFIMQLAQHARHLEVQILADEYGNAISLFGRDCSIQRRHQK
IIEEAPATIAPPSTLEQMERYAVRMAKMVGYVSAGTVEYLYSEDGSFHFLELNPRLQVEH
PCTEMIGDVNLPAAQLQIAMGIPLHRIKDIRVLYGESPWGDSIINFETPDCVPNPRGHVI
AARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGAAGGLHEFADSQFGHCFSWGEN
REEAISNMVVAMKELSIRGDFRTTVEYLIKLLETESFRNNDIDTGWLDHLIAEKVQAERP
DTMLGIVCGALHVADASFRKSMSDFLHSLERGQVLAADSLLNSVNIDLIYEGVKYCLKVA
RQSQTTYVIIMNGSDIEIDVHRLNDGGLLLCYDGNSHTTYMKEEVDSYRITVGNKTCVFE
KERDPTVLRSPSAGKLLQYTVEDGDHIFAGEPYAEIEVMKMVMSLTVSQSGCIHFVKRPG
AVLEPGCVMARMDLDDSSSIHRVELNTATLPPQQPLPMVGEKLHQVFHNVLENLVRVMDG
YCLEEPYFSTKLNEWVATLMKTLRDPSLPLLELQEIMNSVASRIPPAVEKDIRKVMAQYA
SNITSVLCQFPSQRIANILDSHAATLQRKADREVFFMNTQSIVQLVQRYRSGTRGYMKSV
VLDLLKRYLQVEMQFQQAHYDKCVINLREQHKPDMSPVLDYIFSHAQVSKKNLLVTMLID
QLCGRDATLADELMAILNEFTQLSKMENSKVALRARQVLIASHMPSYELRHNQVESIFLS
AIDMYGHQFCPENLKKLILSETSIFDVLPNFFYHANQVVCMAALEVYVRRAYIAYELNSI
QHHQLLDGTCAVDFQFMLPSSHPNRGSSPTLSRLPVAAGGLGQFNVQRQSSELLMDGAFS
PPCQRMGAMVAFQCFDDFKRNFDEVLSSFAEQLMEGASFLESCSSFYEEENMKNNRENPI
HIINVSIKTADTEDDDALVKAFTAFAQSKKAILFEYGIRRMTFLITQKREFPKFFTFRAR
DEFQEDRIYRNLEPALAFQLELNRMRNFDLTAVPCANKKMHLYLGAARVQEGAEVTDYRF
FIRAIMRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNYTSVRTDCNHIFLNFVPTV
IMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGNAIPIRLFLTNESGYYLD
ISLYKEVTDPSSRQIMFQSYGDKQGPLHGMLINTPYVTKDLLQAKRFQAQSLGTTYVYDV
PEMFRQALFKLWVPGDKCPKDVLICTELVLDAEGRLVQMNRQPADNDVGMVAFRMKMKTP
EYPEGRDIIVICNDITHMIGSFGPQEDELFLKASELARAEGIPRIYIAANSGARIGLAEE
VKHMFQVAWIDPADPYKGFKYLYLSPQDYTRISSTNSVHCRHVEEGGESRYIITDIIGKD
EGLGVENLRGSGTIAGESSQAYKEIVTISMVTCRAIGIGAYLVRLGQRVIQVENSHIILT
GAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHTTVPDDFEGVFTILMWLSYMPKNNHSP
VPVRANTDPVDREIEFVPTKAPYNPRWMLAGRPHPMSRGVWQSGFFDHGSFMEIMGSWAQ
TVVVGRARLGGIPLGVIAVETRTVELTIPADPANLDSESKVLQQAGQVWFPDSAFKTAQA
ICDFNRERLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDALHTFHQPVLVYIPPHAELR
GGSWVVIDPTINLLCMELYADRESRGGVLEPEGTVEIKFRRKDLLKTMRRLDSVYASLVE
KLSSPELSDKEIKELEKKLKAREEFLLPIYHQVAVQFVDLHDTPGRMQEKGVITDILDWK
QARTFFYWRLRRLLLEQVVKCEIMEANKDLSDGHMQSMLRRWFVETEGTVKAYLWDNNQA
VVEWLEKHLSTEDGTRSVIRENIKYLKRENALKHIRGLVEANPDIAMDCIIHMSQNISPS
QRASLSHLLATMDTTSTSPS
NT seq 7263 nt   +upstreamnt  +downstreamnt
atgttcctgcttccagctttggcggtcatctggatattaatattgctatggataaataaa
accaaaacagcagcgatgcataggtcaaacaagaagtcagaagaggagtacgtctctact
gcagagagcagctcccgttcacgccaacgttccctgtcgacagctgctcccaaatccaaa
ttcagcagtgagtctgcagatgtttcagccaaaagagcagagcctgatcctctgcaggcc
tcccttaaggtaaattcatggcagccactgccgctgcagaccacccagaaacccgcaaac
accgtcccaccgatgctgagcccaagggctgcggcgagggagcgtctgaagttcttcctc
ggtgcatccgaggataattcctcagacgacgaggttctggtgacaaaacctccgagcggt
gcatctcaacctacgacttctgctccaaaatccgccgctgagttggtgcctgctgatgtg
ttgtcgcccagctcttcagtgctgaagcctagcatgtctggtcctcacttggtgaaaaaa
ggacgtgaacacaggaagatggatctccagagggattttacggtggcctctcctgctgag
tttgtcactcgattcggtggcaaccggatcatagagaaggtgttgatcgccaacaatggc
attgcagcagtcaagtgcatgcgttctattcgccgctggtcctatgagatgtttcgtaat
gagaggatcatccgtttcgtggtcatggtcacccctgaagacttgaaggctaacgcagaa
tacataaaaatggctgaccattatgtgcctgtgcccggtggcgccaacaataacaactac
gccaacgtagagctgattgtagacattgcaaaaagaatcccagtgcaggctgtgtgggcc
ggatggggtcatgcatctgaaaacccaaagctaccggaactcctgaacaaatcagggata
acattcttgggtccatccagtaaagccatgtgggcccttggggacaaggtggcttcgtcc
attgttgcccagagcgctgacattcccacacttccatggagcggatcaggtctgagagtg
gcgtggacggaagaggaccaaagacggggatatgtagtcagcgttcctccagagatctat
aaagagggctgtgttcatgatgtagatgatggtctggctggagctgaaaaaattggttat
ccggtcgttatcaaggcctctgagggtggaggtggaaaaggcatccgaaaagttgaaaat
tcagatgaatttccaagtttcttcagacaggtgcagacagaggttccaggatcacccatt
tttatcatgcaactggctcaacatgcaaggcacctggaggtgcagatactggcagatgag
tacggaaatgcaatctccctgtttggacgggactgctccatccagaggaggcaccagaag
atcatagaggaggctcccgccaccattgctccaccttcaaccttagagcaaatggagcgg
tatgcagtgcggatggccaagatggtgggctacgtcagtgccggtactgtggagtatctc
tactcagaagacggcagcttccactttttggagctgaatcctcgcttgcaggtggaacat
ccatgcacggagatgatcggagatgtaaacttgccagctgcccaacttcagattgcgatg
ggcatccctctgcacagaattaaggatatccgagtgctttatggggaaagtccgtggggc
gactccatcatcaactttgaaactccagactgtgttcctaatccaagagggcacgtgatt
gcagcccgcatcaccagcgagaatccagacgaggggttcaagcccagctccgggactgtg
caggagctgaacttccgcagcagtaaaaacgtctggggttatttcagtgtgggggccgct
ggtggcctccacgaatttgcggattcccagtttgggcactgtttttcgtggggagagaac
cgagaggaagccatctcaaacatggtggtagcgatgaaggagctgtccatcagaggagac
tttaggactacggtggaatacctcatcaagcttctggagactgaaagcttcagaaacaat
gacatcgacactggctggttggatcacctcattgcagagaaagtgcaggcagagagacca
gacaccatgctgggcatcgtttgtggagctctgcatgttgcagatgccagcttcaggaag
agcatgtcggacttcctgcattccctagaaagaggccaggtgctggcggcagacagcctg
ctcaactctgtcaacatcgacctgatatatgaaggagtcaagtactgtttgaaggtggct
cgccaatcccagacaacttacgtcatcatcatgaacggctcggacattgagatagacgtc
cacaggttgaatgacgggggcctcctgctgtgttatgatggcaacagccacaccacatac
atgaaggaggaagtagacagctaccgcatcactgtcggtaacaagacctgtgtgtttgag
aaggagagggatcccacagtgctgaggtctccctctgctggtaaactgctgcagtacacc
gtggaggatggagatcatatttttgcaggagaaccttacgcagagattgaggtgatgaag
atggtgatgagtctgaccgtgtcgcagtctggttgtatacactttgtaaagaggccaggg
gcggttctggagcccggctgtgtcatggcgcgtatggatctggacgactccagcagtata
cacagggtggagctcaacacagccactctgccgccccagcagccgctacctatggtcggg
gaaaagcttcaccaggtgttccacaacgtgctcgaaaatctggtcagagtgatggacggg
tactgcctcgaagagccttacttcagcacaaaactgaacgaatgggtcgcgaccctgatg
aagaccctgagggatccgtctcttccactgctggagcttcaggagatcatgaacagcgtg
gccagccgtatcccccctgctgtggagaaggacatccggaaggtcatggctcagtatgcg
agcaacatcacctctgtcctctgccagttccccagtcaaaggattgctaacattttagac
agccatgcagccacgctgcagaggaaggctgaccgggaggttttcttcatgaacactcaa
agtattgttcagctggtgcagagatatcgcagtggaacccgtggttacatgaaatctgtg
gttcttgatctgctgaagcggtacctgcaggtcgagatgcagttccagcaagctcactat
gataagtgtgtgatcaacttgagagagcagcacaagcccgacatgagtcctgtgctcgac
tacatcttttctcacgctcaggtgtccaaaaaaaacctcctggtgacgatgctcattgac
cagctgtgtggacgtgacgccacccttgcagatgagctcatggctattctaaatgaattc
acacagttgagcaagatggaaaattcaaaggttgcactgagagccagacaggtgttgatt
gcctcccacatgccatcgtatgaactgagacacaaccaggtggagtccatcttcctgtca
gctattgatatgtacggccaccagttttgcccagaaaacttgaagaaacttattctctct
gaaacctcaatttttgacgtcttgcccaacttcttctatcacgcaaatcaagttgtgtgc
atggctgctttggaggtgtatgttcgcagagcatacattgcctacgagctgaatagcatc
cagcatcaccagctgctggacggaacgtgtgccgtggacttccagttcatgttgccgtca
tcgcacccaaacagagggagcagccctactctgagcaggcttccggtggcagcaggcgga
ttgggccagtttaacgttcaacggcagagcagtgagctgctaatggacggagccttctct
ccaccttgccaaagaatgggagctatggtagctttccagtgctttgacgacttcaaaagg
aattttgatgaagttctgtcgagtttcgctgaacagctcatggagggagcttcgttctta
gagtcctgctctagtttctacgaggaggagaacatgaagaataacagggagaaccccatc
cacatcattaacgtgtcgataaaaacagcagacacggaggacgacgacgccttggtgaag
gccttcactgcctttgctcagtcaaagaaagccattctttttgagtatgggatcaggaga
atgacctttttgattactcagaagagagaatttccaaagttcttcacattcagggctcga
gatgagttccaggaggaccgaatttacagaaatctggagccagctctggcgtttcagctg
gagctcaaccgaatgaggaactttgacctgacagcagttccctgcgccaacaagaagatg
cacctgtacctgggagccgctcgggtccaagagggcgcggaagtgacggactaccgcttc
ttcatccgggcaattatgcgccactcagatctcattacaaaagaagcttcatttgagtac
cttcaaaatgaaggggagcggctcctgctggaggccatggatgagttggaggtcgccttc
aattacaccagcgttcgcacagattgcaatcacatcttccttaactttgtccctactgtc
atcatggacccatctaaaattgaggagtctgttcgctccatggtgatgcgctacggcagt
cgcctttggaaactgcgggtcttgcaggccgagctgaagatcaacatccgcctgacacca
actggaaacgcaattcctatccgcctctttctcactaatgaatcaggctattatttggac
atcagtctgtataaagaagtcacggacccaagctctcgacagatcatgtttcagtcttat
ggagacaagcagggtccgctgcacggcatgctgatcaacactccttatgtgaccaaagac
ctgctgcaagccaagcgcttccaggctcaatctctgggcaccacatatgtatacgatgtc
cctgagatgttcagacaggcattgttcaagctttgggttcctggagacaaatgtcctaaa
gacgtgctgatctgcacggagctcgttctggacgcggaaggtcgacttgttcagatgaac
cgtcagcctgcggataatgacgtaggaatggtggcctttaggatgaagatgaagacccct
gagtacccagagggcagagacattatcgtgatatgtaacgacatcactcacatgatcggc
tcgtttggtcctcaggaggacgagctgtttctcaaggcgtcagagctggctcgggccgag
ggaatcccccgcatttacatcgcagccaacagcggcgcgcgcatcggactcgcagaagag
gtcaaacatatgttccaggtggcctggattgacccagcggacccctacaagggtttcaaa
tatctttacctgtcgccccaggactacacccggatcagctccaccaactccgtccattgt
cggcatgtagaggaaggaggagagtccagatacattatcaccgacatcattgggaaagac
gaaggtcttggcgttgagaacctgcgcggttcaggcaccatcgcaggggaatcttctcag
gcctacaaagagatcgtcaccatcagtatggtgacgtgccgagcgataggaatcggagcc
tatctggtccgtttggggcagcgagtgatccaggtggagaactcccacatcatcctgacc
ggagctggtgctcttaacaaggttctgggtagagaggtctacacctccaacaaccagctg
gggggaattcagatcatgcacaacaacggtgtcacacacacaaccgtccctgatgacttc
gagggcgtcttcaccatcctgatgtggctttcttacatgccaaagaacaaccactccccc
gtccccgttagagcaaacacagacccagtagacagagagatagagtttgttcccactaag
gccccttacaacccccgctggatgctggccggcaggcctcaccccatgtcaagaggcgtg
tggcagagcggattctttgaccacggctctttcatggagatcatggggtcctgggctcaa
actgtcgttgtaggaagagcgaggttgggaggaatccccctcggtgtaatcgctgttgaa
acacgcacagttgagctcaccatccctgcagatcctgcaaacctggattcagaatctaaa
gttctgcagcaggctggccaagtttggtttccagattctgctttcaaaacggctcaggca
atttgtgactttaaccgtgaacgtctgcctctcatggtgtttgccaactggagaggcttc
tccggaggaatgaaagatatgtatgaccaggtgctgaagtttggagcctacattgtggac
gctctgcacacttttcaccagccggtgttggtgtacatcccaccccatgcagagttgaga
ggaggatcctgggtggtaatagatcccaccatcaacctgctgtgtatggagctctacgct
gatagggagagcagaggtggcgtcctggagcctgagggcacagtggagattaaattcagg
agaaaggacctactgaaaacaatgaggagactcgattcagtctacgccagtctggttgag
aagctctcttctccagaactgtctgacaaggagatcaaggaactggagaagaagctcaaa
gcaagggaggaattcctgttgcccatctaccaccaggtggcagtgcagtttgtcgatctg
cacgacactccgggcagaatgcaggagaaaggagtgatcactgatattttagactggaaa
caggcgcggaccttcttctactggcgtctgcggcggctcctgctggagcaggtggtcaag
tgtgagatcatggaggccaacaaggacctcagtgacggacacatgcagtcaatgctgcgg
agatggttcgttgaaacggagggaacagtcaaggcttacctttgggataacaaccaggca
gtggtggagtggcttgagaagcacttgtccacagaggacggcacccgctcagtcattcga
gaaaatatcaagtacttgaaaagagaaaatgctttaaagcatattcgtggcttggtggag
gccaaccctgacatagcgatggactgcatcatccacatgagccagaacatttctccctcc
cagagggcctcgttgtcgcatctgcttgcgacgatggacaccaccagcaccagtcccagt
taa

DBGET integrated database retrieval system