KEGG   Poecilia reticulata (guppy): 103470792Help
Entry
103470792         CDS       T05149                                 

Definition
(RefSeq) actin, cytoplasmic 1-like
  KO
K05692  actin beta/gamma 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04145  Phagosome
pret04210  Apoptosis
pret04510  Focal adhesion
pret04520  Adherens junction
pret04530  Tight junction
pret04810  Regulation of actin cytoskeleton
pret05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pret00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103470792
  09143 Cell growth and death
   04210 Apoptosis
    103470792
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103470792
   04520 Adherens junction
    103470792
   04530 Tight junction
    103470792
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103470792
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103470792
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pret03021]
    103470792
   03019 Messenger RNA biogenesis [BR:pret03019]
    103470792
   03036 Chromosome and associated proteins [BR:pret03036]
    103470792
   03029 Mitochondrial biogenesis [BR:pret03029]
    103470792
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pret04812]
    103470792
   04147 Exosome [BR:pret04147]
    103470792
Transcription machinery [BR:pret03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     103470792
Messenger RNA biogenesis [BR:pret03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103470792
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     103470792
    NuA4 complex
     103470792
  Chromatin remodeling factors
   BAF complex
    103470792
   PBAF complex
    103470792
   SWR1 complex
    103470792
Mitochondrial biogenesis [BR:pret03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    103470792
Cytoskeleton proteins [BR:pret04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     103470792
Exosome [BR:pret04147]
 Exosomal proteins
  Proteins found in most exosomes
   103470792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 103470792
NCBI-ProteinID: XP_008417682
LinkDB All DBs
Position
LG9
AA seq 375 aa AA seqDB search
MEDDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITGLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPAIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgatgtctctgctctcgtcgttgacaacggatccggtatgtgcaaagccggg
tttgctggggacgacgctcctcgggccgtttttccctccatcgttgggcgacccagacac
cagggtgtgatggtggggatgggccagaaggacagctacgtgggagacgaggcccagagc
aagaggggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcatcacaccttctacaacgagctccgtgtggctccagaggaa
catccggtcctgctgactgaagctcctctcaaccccaaagccaacagggagaagatgacc
cagatcatgtttgagacgttcaacactcctgccatgtatgtggccatccaggccgtcctg
tcgctgtacgcctcgggtcgaaccacaggtattgtgatggactctggtgacggcgtcagc
cataccgtcccgatctatgaaggctacgctcttcctcacgccatcctgcgtctggatctg
gctggcagagatctgacagattacctgatgaagatcctgacggagagaggctacagcttc
accaccaccgctgagcgtgagatcgtgcgcgacatcaaggagaagctctgctatgtggct
ctggacttcgagcaggagatgcagacggcagcttcctcttcttccctggagaaaagctac
gagcttcctgacggccaagtcatcaccatcggcaacgagcgtttccgctgcccagaggcg
ctcttccagccgtctttcctcggaatggagtctgctggtattcatgaaaccacgtacaac
agcatcatgaagtgcgacgtggacatccgtaaggatctgtacgccaacaccgtcctgtcc
ggcggcaccaccatgtaccctggaatcgctgaccgcatgcagaaggagatcaccggcctg
gccccgcccaccatgaagatcaagatcatcgctcccccagagaggaagtactcggtctgg
atcggcggctccatcctggcctctctctccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtccggtccagccatcgtccacagaaagtgtttctaa

DBGET integrated database retrieval system